KEGG   Nocardiopsis alba: B005_3793Help
Entry
B005_3793         CDS       T02218                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nal  Nocardiopsis alba
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    B005_3793 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B005_3793 (murE)
Enzymes [BR:nal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     B005_3793 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3978656..3980320
Genome map
AA seq 554 aa AA seqDB search
MRPEHTSLRPLSDLVTTLGSDATLLRPDTDPERPADMPPREVHVRGITHDSRRVRQGDLY
AALPGTRVHGAEFSRQAADAEASAILTDAEGAESAAATGLPVIVVPDVRAVLGPVASWVY
GDPARDLLLVGTTGTSGKTTISYLIESGLRKAGMSTGLVGTVEMRVGDERVASSLTTPEA
TDLHGLFAVMAERGITAAAMEVSSHALALGRVGGARYDVAIFTNLSQDHLDFHSDLRDYF
DTKARLFTPEYCDIAVVNTDDRFGRALVDMVAGRGDIPVTTFAVEGGSDAGPENGMEADW
NAVDVRLGDTGSSFRVVGPGGMEAEASVALPGPFNVSNAMAAIVGLVEAGLPMETAIAGV
AAAPGVPGRMEPVAARSAASEQDFTALVDYSHKPGAIEAVLDSLRATTKGRITMVVGCGG
DRDRAKRPLMGEAAARLADQVIITNDNPRSEDPVSIAAAMLEGVAKVPENHRAHVTVELD
RAEAIGLGVARTGPGDVIVVAGKGHETGQYVKGEMLPFDDREVLLNAIEDALRSRASERL
GSALQNVHRAPDPG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcgacctgaacacaccagtctccgtccactgtccgacctcgtcaccacgctcggctcg
gacgccaccctgctgcgaccggacaccgatccggaacgcccggcggacatgcccccacgg
gaggtccatgtccgcggtatcacccatgactcccggcgcgtccgacagggcgacctgtac
gccgccctgcccggtacccgtgtccacggcgccgagttctcccgacaggcggccgacgcc
gaggcctccgcgatcctcaccgacgcggagggcgccgagagcgccgccgccaccggcctg
ccggtgatcgtggtgcccgacgtgcgggccgtgctcggcccggtcgcctcctgggtctac
ggcgaccccgcccgggacctgctcctggtcggtaccaccgggaccagtggcaagaccacg
atcagctacctgatcgagtccggtctgcgcaaggccggtatgagcaccggcctggtgggc
accgtggagatgagggtgggcgacgaacgggtcgcctcctccctgaccactcccgaggcc
accgacctgcacggcctgttcgcggtcatggccgaacgcgggatcaccgccgccgccatg
gaggtctccagccacgccctggccctgggccgggtcggcggagcccgctacgacgtggcg
atcttcaccaacctgtcccaggaccacctggacttccactcggacctgcgcgactacttc
gacaccaaggcgcgcctgttcacgcccgagtactgcgacatcgcggtggtcaacaccgac
gaccgcttcggtcgggccctggtggacatggtcgcggggcgcggggacatccccgtcacc
accttcgcggtggagggcggatcggacgcgggccccgagaacgggatggaggccgactgg
aacgccgtcgacgtccgtctgggggacaccggaagctccttccgcgtggtcggccccggc
ggaatggaggcggaggcctcggtggccctgcccggccccttcaacgtctccaacgccatg
gcggccatcgtcggtctggtggaggccggtcttcccatggagaccgccatcgccggtgtg
gcggccgcccccggggtccccgggcggatggagccggtggcggcccggagcgcggcgtcg
gaacaggacttcaccgccctggtcgactactcgcacaagcccggggcgatcgaggcggta
ctcgactcgctgcgcgccaccaccaaggggcggatcaccatggtggtcggctgtggtggc
gaccgtgaccgggccaaacgcccgctcatgggcgaggccgcggcgcgcctggccgaccag
gtgatcatcaccaacgacaaccctcggagcgaggaccccgtctccatcgcggccgcgatg
ctcgaaggggtcgccaaggtccccgagaaccaccgtgcccacgtcaccgtggaactcgac
cgggccgaggccatcggcctgggcgtggccaggaccgggccgggcgatgtgatcgtcgtc
gcgggcaagggccacgagaccggccagtacgtcaagggcgagatgctgcccttcgacgac
cgcgaggtcctgctcaacgccatcgaggacgctctgcgcagtcgggccagcgaacgtctg
ggcagtgcgctccagaacgtgcaccgggcccctgacccgggctga

DBGET integrated database retrieval system