KEGG   Nocardiopsis alba: B005_3793Help
Entry
B005_3793         CDS       T02218                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nal  Nocardiopsis alba
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nal00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3978656..3980320
Genome map
AA seq 554 aa AA seqDB search
MRPEHTSLRPLSDLVTTLGSDATLLRPDTDPERPADMPPREVHVRGITHDSRRVRQGDLY
AALPGTRVHGAEFSRQAADAEASAILTDAEGAESAAATGLPVIVVPDVRAVLGPVASWVY
GDPARDLLLVGTTGTSGKTTISYLIESGLRKAGMSTGLVGTVEMRVGDERVASSLTTPEA
TDLHGLFAVMAERGITAAAMEVSSHALALGRVGGARYDVAIFTNLSQDHLDFHSDLRDYF
DTKARLFTPEYCDIAVVNTDDRFGRALVDMVAGRGDIPVTTFAVEGGSDAGPENGMEADW
NAVDVRLGDTGSSFRVVGPGGMEAEASVALPGPFNVSNAMAAIVGLVEAGLPMETAIAGV
AAAPGVPGRMEPVAARSAASEQDFTALVDYSHKPGAIEAVLDSLRATTKGRITMVVGCGG
DRDRAKRPLMGEAAARLADQVIITNDNPRSEDPVSIAAAMLEGVAKVPENHRAHVTVELD
RAEAIGLGVARTGPGDVIVVAGKGHETGQYVKGEMLPFDDREVLLNAIEDALRSRASERL
GSALQNVHRAPDPG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcgacctgaacacaccagtctccgtccactgtccgacctcgtcaccacgctcggctcg
gacgccaccctgctgcgaccggacaccgatccggaacgcccggcggacatgcccccacgg
gaggtccatgtccgcggtatcacccatgactcccggcgcgtccgacagggcgacctgtac
gccgccctgcccggtacccgtgtccacggcgccgagttctcccgacaggcggccgacgcc
gaggcctccgcgatcctcaccgacgcggagggcgccgagagcgccgccgccaccggcctg
ccggtgatcgtggtgcccgacgtgcgggccgtgctcggcccggtcgcctcctgggtctac
ggcgaccccgcccgggacctgctcctggtcggtaccaccgggaccagtggcaagaccacg
atcagctacctgatcgagtccggtctgcgcaaggccggtatgagcaccggcctggtgggc
accgtggagatgagggtgggcgacgaacgggtcgcctcctccctgaccactcccgaggcc
accgacctgcacggcctgttcgcggtcatggccgaacgcgggatcaccgccgccgccatg
gaggtctccagccacgccctggccctgggccgggtcggcggagcccgctacgacgtggcg
atcttcaccaacctgtcccaggaccacctggacttccactcggacctgcgcgactacttc
gacaccaaggcgcgcctgttcacgcccgagtactgcgacatcgcggtggtcaacaccgac
gaccgcttcggtcgggccctggtggacatggtcgcggggcgcggggacatccccgtcacc
accttcgcggtggagggcggatcggacgcgggccccgagaacgggatggaggccgactgg
aacgccgtcgacgtccgtctgggggacaccggaagctccttccgcgtggtcggccccggc
ggaatggaggcggaggcctcggtggccctgcccggccccttcaacgtctccaacgccatg
gcggccatcgtcggtctggtggaggccggtcttcccatggagaccgccatcgccggtgtg
gcggccgcccccggggtccccgggcggatggagccggtggcggcccggagcgcggcgtcg
gaacaggacttcaccgccctggtcgactactcgcacaagcccggggcgatcgaggcggta
ctcgactcgctgcgcgccaccaccaaggggcggatcaccatggtggtcggctgtggtggc
gaccgtgaccgggccaaacgcccgctcatgggcgaggccgcggcgcgcctggccgaccag
gtgatcatcaccaacgacaaccctcggagcgaggaccccgtctccatcgcggccgcgatg
ctcgaaggggtcgccaaggtccccgagaaccaccgtgcccacgtcaccgtggaactcgac
cgggccgaggccatcggcctgggcgtggccaggaccgggccgggcgatgtgatcgtcgtc
gcgggcaagggccacgagaccggccagtacgtcaagggcgagatgctgcccttcgacgac
cgcgaggtcctgctcaacgccatcgaggacgctctgcgcagtcgggccagcgaacgtctg
ggcagtgcgctccagaacgtgcaccgggcccctgacccgggctga

DBGET integrated database retrieval system