KEGG   Nocardiopsis alba: B005_3833Help
Entry
B005_3833         CDS       T02218                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nal  Nocardiopsis alba
Pathway
nal00340  Histidine metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01230  Biosynthesis of amino acids
Module
nal_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    B005_3833 (hisD)
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     B005_3833 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFR09351
UniProt: J7L9J2
Position
4023102..4024499
Genome map
AA seq 465 aa AA seqDB search
MISRIDLRGSQDDPRDSLPRAEIDVADATERVRPICDDVRHRGTEALIELTERFDGVRLT
DIRVPKDALDRALTELDPRVRAALEESIRRARKVHSAQRREDHTTRVVPGGTVTEKWIPV
DRVGLYVPGGRAVYPSSVIMNVVPAQEAGVSSLAVTSPPQKDFGGLPHPTILAACALLGV
EEVYAVGGAQAVAMFAHGTEDCPRADMVTGPGNIWVAAAKRLLKGIIGIDAEAGPTEIAV
LADHTADPDHVAADLISQAEHDVVAASVLVTPDEALADAVTERLAVRAAATRHSERVLEA
LAGPQSGIVLVDDLEQGLAVVNAYAAEHLEVITDQASVWADRVRNAGAIFVGPHSPVSLG
DYAAGSNHVLPTGGCACHSGGLSVAGCTSSNTTATRWPTSPTMSSPWPRPRTCPPTARRS
PPGSGTATTGTETDHTRRSGRTDRSSPTTRVTGDVGRPSHHRPRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtcgaatcgacctccgaggttcccaggacgacccgcgcgactcccttccgcgc
gccgaaatcgatgtggcggacgccaccgaacgcgtccgtcccatctgtgatgacgtacgc
catcgcggaaccgaggccctgatcgaactcaccgagcgcttcgacggtgtgcggctcacc
gacatccgcgtccccaaggacgccctcgaccgcgccctcaccgaactcgacccccgggtg
cgcgccgccctggaggagtccatccggcgcgcccgcaaggtccactccgcccaacggcgt
gaggaccacaccacccgcgtggtgcccggcggcaccgtcaccgagaagtggatcccggtc
gaccgggtcggcctctacgtgccgggcggacgggccgtctacccctccagcgtcatcatg
aacgtcgtccccgcccaagaggcgggcgtgtcctccctggcggtcacctcaccgccccag
aaggacttcggcggcttgccccacccgacgatcctcgccgcctgcgccctgctcggcgtc
gaggaggtctacgcggtcggcggagcccaggccgtggcgatgttcgcccacggcaccgag
gactgcccgcgcgcggacatggtcaccggccccgggaacatctgggtcgccgccgccaag
cgcctgctcaagggcatcatcggtatcgacgccgaggccggccccaccgagatcgcggtt
ctggccgaccacaccgccgaccccgaccacgtcgccgccgacctcatcagtcaggccgag
cacgacgtcgtcgccgcctccgtcctggtgaccccggacgaggccctggccgacgcggtc
accgaacgtctcgccgtgcgcgccgccgccacccggcacagcgagcgtgtcctggaggcc
ctggcgggtccccagtccggcatcgtcctggtcgacgacctcgaacagggcctggccgtc
gtcaacgcctacgccgcggaacacctggaggtcatcaccgaccaggcgtccgtgtgggcc
gaccgggtgcgcaacgccggggcgatcttcgtcgggccgcactccccggtctcgctcggc
gactacgccgccggctccaaccacgtcctccccacggggggctgcgcctgccacagcggc
gggctgagcgtggcggggtgcacgtcgtcgaatacgaccgcgacgcgctggccgacgtcg
cccaccatgtcatcaccctggccgaggccgaggacctgcccgcccacggcgaggcgatcg
ccgcccgggtcgggcacggcgacgaccgggactgagaccgaccacacccgacggagcggg
cggaccgaccggagctccccgaccaccagagtcacaggagacgtcggccgcccctcccac
caccgaccacgagtgtga

DBGET integrated database retrieval system