KEGG   Nocardiopsis alba: B005_3833Help
Entry
B005_3833         CDS       T02218                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nal  Nocardiopsis alba
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nal01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nal00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4023102..4024499
Genome map
AA seq 465 aa AA seqDB search
MISRIDLRGSQDDPRDSLPRAEIDVADATERVRPICDDVRHRGTEALIELTERFDGVRLT
DIRVPKDALDRALTELDPRVRAALEESIRRARKVHSAQRREDHTTRVVPGGTVTEKWIPV
DRVGLYVPGGRAVYPSSVIMNVVPAQEAGVSSLAVTSPPQKDFGGLPHPTILAACALLGV
EEVYAVGGAQAVAMFAHGTEDCPRADMVTGPGNIWVAAAKRLLKGIIGIDAEAGPTEIAV
LADHTADPDHVAADLISQAEHDVVAASVLVTPDEALADAVTERLAVRAAATRHSERVLEA
LAGPQSGIVLVDDLEQGLAVVNAYAAEHLEVITDQASVWADRVRNAGAIFVGPHSPVSLG
DYAAGSNHVLPTGGCACHSGGLSVAGCTSSNTTATRWPTSPTMSSPWPRPRTCPPTARRS
PPGSGTATTGTETDHTRRSGRTDRSSPTTRVTGDVGRPSHHRPRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtcgaatcgacctccgaggttcccaggacgacccgcgcgactcccttccgcgc
gccgaaatcgatgtggcggacgccaccgaacgcgtccgtcccatctgtgatgacgtacgc
catcgcggaaccgaggccctgatcgaactcaccgagcgcttcgacggtgtgcggctcacc
gacatccgcgtccccaaggacgccctcgaccgcgccctcaccgaactcgacccccgggtg
cgcgccgccctggaggagtccatccggcgcgcccgcaaggtccactccgcccaacggcgt
gaggaccacaccacccgcgtggtgcccggcggcaccgtcaccgagaagtggatcccggtc
gaccgggtcggcctctacgtgccgggcggacgggccgtctacccctccagcgtcatcatg
aacgtcgtccccgcccaagaggcgggcgtgtcctccctggcggtcacctcaccgccccag
aaggacttcggcggcttgccccacccgacgatcctcgccgcctgcgccctgctcggcgtc
gaggaggtctacgcggtcggcggagcccaggccgtggcgatgttcgcccacggcaccgag
gactgcccgcgcgcggacatggtcaccggccccgggaacatctgggtcgccgccgccaag
cgcctgctcaagggcatcatcggtatcgacgccgaggccggccccaccgagatcgcggtt
ctggccgaccacaccgccgaccccgaccacgtcgccgccgacctcatcagtcaggccgag
cacgacgtcgtcgccgcctccgtcctggtgaccccggacgaggccctggccgacgcggtc
accgaacgtctcgccgtgcgcgccgccgccacccggcacagcgagcgtgtcctggaggcc
ctggcgggtccccagtccggcatcgtcctggtcgacgacctcgaacagggcctggccgtc
gtcaacgcctacgccgcggaacacctggaggtcatcaccgaccaggcgtccgtgtgggcc
gaccgggtgcgcaacgccggggcgatcttcgtcgggccgcactccccggtctcgctcggc
gactacgccgccggctccaaccacgtcctccccacggggggctgcgcctgccacagcggc
gggctgagcgtggcggggtgcacgtcgtcgaatacgaccgcgacgcgctggccgacgtcg
cccaccatgtcatcaccctggccgaggccgaggacctgcccgcccacggcgaggcgatcg
ccgcccgggtcgggcacggcgacgaccgggactgagaccgaccacacccgacggagcggg
cggaccgaccggagctccccgaccaccagagtcacaggagacgtcggccgcccctcccac
caccgaccacgagtgtga

DBGET integrated database retrieval system