KEGG   Nocardiopsis alba: B005_3851Help
Entry
B005_3851         CDS       T02218                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nal  Nocardiopsis alba
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B005_3851 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B005_3851 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B005_3851 (trpB)
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B005_3851 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4040013..4041212
Genome map
AA seq 399 aa AA seqDB search
MPDELGHYGRFGGRFAPEALIAALDEVEAEWAKAKEDPVFQAEFDDLLKNYAGRPSLLTE
ARNFSEHAGGARILLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAETGAGQHGVATA
TACALLGLECRIYMGEEDTRRQALNVARMRMLGAEVVPVTIGSRTLKDAINETFRDWVAN
VDRTHYLFGTAAGPHPFPKLVRDLHFTVGAEARRQALELTGRLPDAVTACVGGGSNAIAI
FAAFIPDEEVALYGFEAGGEGADTDRTAASITAGSPGVFHGARTFVLQDEYGQTLPSHSI
SAGLDYPAVGPEHAHLAATGRATYEPVTDAEAMEAFRLLCRTEGIIPAIESAHALGGAIR
LGRRLGPDSIILVNLSGRGDKDVNTAADYFGLVDSEGQA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgagctggggcactacggccgtttcggtgggcgtttcgcccccgaggccctc
atcgccgccctcgacgaggtcgaggccgaatgggccaaggccaaggaggacccggtcttc
caggccgagttcgacgacctgctcaagaactacgccggccgtccgagcctgctcaccgag
gcccgcaacttctccgagcacgcgggcggcgcccgcatcctcctcaagcgcgaggacctc
aaccacaccggctcgcacaagatcaacaacgtgctgggccaggccctgctgaccaagcgc
atgggcaagacgcgcgtcatcgccgagaccggtgccggccagcacggcgtggccaccgcc
accgcctgcgcgctgctcggcctggagtgccgcatctacatgggcgaggaggacacccgc
cgtcaggccctcaacgtcgcccggatgaggatgctcggcgccgaggtcgtcccggtcacg
atcggcagccgcacgctcaaggacgccatcaacgagaccttccgggactgggtcgccaac
gtcgaccgcacccactacctcttcggcaccgccgccggaccgcaccccttccccaagctg
gtgcgcgacctgcacttcaccgtgggcgccgaggcccgcaggcaggcgctggaactcacc
ggccgtctccccgacgccgtcaccgcctgcgtgggcggagggtcgaacgccatcgcgatc
ttcgccgccttcatccccgacgaggaggtggccctgtacggcttcgaggccgggggagag
ggcgccgacaccgaccgcaccgccgcctccatcaccgcgggcagccccggggtcttccac
ggggcccgtaccttcgtcctccaggacgagtacggccagaccctgcccagccactccatc
tccgccggactcgactacccggcggtggggcccgagcacgcccacctggccgccaccggc
cgcgccacctacgagcccgtcaccgacgccgaggcgatggaggccttccggctgctgtgc
cggaccgagggcatcatccccgccatcgagagcgcgcacgccctgggcggggcgatccgg
ctgggccgcaggctcggcccggactccatcatcctggtgaacctctccggacgcggggac
aaggacgtcaacaccgccgccgactacttcggcctcgtcgactcggagggacaggcctga

DBGET integrated database retrieval system