KEGG   Nocardiopsis alba: B005_3852Help
Entry
B005_3852         CDS       T02218                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nal  Nocardiopsis alba
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B005_3852 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B005_3852 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B005_3852 (trpA)
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B005_3852 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4041227..4042024
Genome map
AA seq 265 aa AA seqDB search
MQTKMAEARAAGRAALVGYLPAGFPDVESSIRVVQAMVEGGCDVIEVGLPYSDPMMDGPT
IQRAADMALNSGTTTEDVFRVVEATAATGAAALVMSYWNPIERYGVERFATGLADAGGAG
VITPDLIPEEAREWYDASEKAGLDRIFLVAPSSSDRRLALTTEACSGFVYAASLMGVTGT
RAQVADTAETLVRRTREVTRDSELPICVGLGISTAAQAAEVAAYADGVIVGAGFCQRILD
APDLETGLIAVRSFAEELAGGVRSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaccaagatggccgaggcgcgcgccgccggccgggccgccctcgtcggctacctc
cccgcgggcttccccgacgtggagtcctccatccgcgtcgtccaggccatggtcgagggc
ggctgcgacgtcatcgaggtcggcctgccctactccgaccccatgatggacggccccacc
atccagcgggcggccgatatggcgctgaactccggcaccaccacggaggacgtgttccga
gtggtggaggccaccgccgccaccggtgccgcggccctggtcatgtcctactggaacccg
atcgaacgctacggcgtggagcgcttcgccaccggcctggccgacgccggcggggccggg
gtcatcacccccgacctcatcccggaggaggcccgcgagtggtacgacgcctcggagaag
gccgggctcgaccggatcttcctggtggcgccctcctcctcggaccggcgtctggcgctg
accaccgaggcctgtagcgggttcgtgtacgcggcctcgctcatgggcgtcaccggtacc
cgggcccaggtcgccgacaccgccgagaccctggtccggcgcacccgcgaggtcacccgg
gactcggagttgccgatctgcgtggggctgggcatctccaccgcggcccaggccgccgag
gtcgccgcctacgccgacggggtcatcgtcggcgccgggttctgccagcggatcctggac
gctccggacctggagaccgggctgatcgcggtccgttccttcgccgaggagctggccgga
ggcgtccgctcccgctga

DBGET integrated database retrieval system