KEGG   Nocardiopsis alba: B005_3970Help
Entry
B005_3970         CDS       T02218                                 

Definition
cellulase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nal  Nocardiopsis alba
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B005_3970
Enzymes [BR:nal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     B005_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4158440..4159522
Genome map
AA seq 360 aa AA seqDB search
MARLRTTTPARHPYRTLSLTAVGALLLGAAAFFPASGQELEPVSSTSPDTTAIDEHGRLS
VCGIKLCDENGDQVQLTGMSTHGIQWYDHCLTDGSLDALADDWRADVLRVSMYIQEGGYE
TDPRGFTDRVHELIEEGTERGLYVIVDWHMLTPGDPNHNTERAKEFFQEIASVHADKDNL
LYEIANEPNGVSWNSIKGYAEEVIPVIRAEDPDSLVLVGTRAWSSLGVSEGSDHSEIVAD
PVDADNIMYVYHFYAASHDTVHYDTFERAVRELPLFVTEFGTQEHTGDGPDDFSSAQRYL
DLMEREKISWVNWNFSDDFRSGAVFETGTCNAGGPWAGTDSLKPAGEWIRERIRTSGLSG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcgtcttcgcacgaccacccccgcccgccacccgtaccggaccctctccctcacc
gccgtgggagcgctcctgctcggcgcggccgcgttcttcccggcctccggccaggaactc
gaaccggtctcgtccacctccccggacaccaccgccatcgacgaacacggacggctctcc
gtctgcgggatcaagctctgcgacgagaacggtgaccaggtccagctcaccgggatgagc
acccacggcatccagtggtacgaccactgcctcaccgacggttccctggacgccctggcc
gacgactggagggccgacgtccttcgggtatccatgtacatccaggagggcggctacgag
accgacccccggggcttcaccgaccgcgtccacgagctcatcgaggagggcaccgagcgc
ggcctctacgtgatcgtcgactggcacatgctcacgcccggcgacccgaaccacaacacc
gagcgggccaaggagttcttccaggagatcgcctcggtccacgcggacaaggacaacctg
ctctacgagatcgccaacgagcccaacggggtctcctggaactcgatcaagggctacgcc
gaggaggtcatcccggtcatccgcgccgaggaccccgactccctcgtgctggtcggcacc
cgtgcctggtcctcactgggggtgtcggagggctccgaccactccgagatcgtcgccgac
ccggtggacgcggacaacatcatgtacgtgtaccacttctacgcggcctcccacgacacg
gtgcactacgacaccttcgagcgggccgtgcgggagcttccgctcttcgtcaccgagttc
ggcacccaggagcacaccggtgacgggcctgacgacttctcctccgctcagcgttacctc
gacctgatggagcgggagaagatcagctgggtgaactggaacttctcggacgacttccgc
tccggcgcggtcttcgagacgggcacctgtaacgcgggcggcccctgggccggtaccgac
tccctcaagcccgcgggggagtggatccgtgagcggatccggaccagcggcctctccggc
tga

DBGET integrated database retrieval system