KEGG   Nocardiopsis alba: B005_4017Help
Entry
B005_4017         CDS       T02218                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nal  Nocardiopsis alba
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nal00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4210538..4211311
Genome map
AA seq 257 aa AA seqDB search
MGVINRTPDSFYDRGATYALDAALASADHAVAAGVDIIDVGGVKAGYGSYVGVDEEIRRT
VPFVRELRDRHPEVVISVDTWRAEVGRACAEAGADMINDTWAGADPDLARVAAECGTGLV
CSHSGGLAPRTDPHRVRYDDVVADVVAGVCALAERAISLGVRPDGVMIDPTHDFGKNTYH
SLELTRRLRELADTGLPVLVAVSNKDFVGETLGAGLTERGDGTLATLVVSAREGARVFRV
HDVVAARTALDVVAAVG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgatcaacaggacccccgactccttctacgaccggggcgccacctacgccctg
gacgccgccctggcctccgccgaccacgccgtggccgccggcgtcgacatcatcgacgtc
ggcggggtcaaggcgggctacggctcctacgtgggggtggacgaggagatccgccgcacg
gtgccgttcgtgcgcgagttgcgggaccgccaccccgaggtggtgatctccgtcgacacc
tggcgggccgaggtcggtcgtgcctgcgcggaggcgggcgccgacatgatcaacgacacc
tgggccggcgccgatccggatctggcccgggtggccgccgagtgcggtaccggtctggtg
tgcagtcacagcggaggcctggccccgcgcaccgacccccaccgggtccgctacgacgac
gtggtcgccgacgtggtggcgggcgtgtgcgccctggccgaacgggcgatctcgctgggg
gtgcgtccggacggggtgatgatcgaccccacccacgacttcggcaagaacacctaccac
tcgctggagctcacccgacggctgagggagttggcggacacggggctgccggtgttggtg
gcggtctccaacaaggacttcgtgggggagaccctcggcgcggggctgaccgaacgcggc
gacggcacgctcgccaccctcgtggtctcggcgcgtgagggggcccgtgtcttccgggtc
cacgacgtggtggcggcgcgcaccgcgttggacgtggtcgcggcggtcggctga

DBGET integrated database retrieval system