KEGG   Nocardiopsis alba: B005_4094Help
Entry
B005_4094         CDS       T02218                                 

Gene name
ppgmk
Definition
inorganic polyphosphate/ATP-glucomannokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_4094 (ppgmk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_4094 (ppgmk)
   00520 Amino sugar and nucleotide sugar metabolism
    B005_4094 (ppgmk)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     B005_4094 (ppgmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4310014..4310784)
Genome map
AA seq 256 aa AA seqDB search
MSEPTTGLGIDIGGSGIKGAPVDLDSGEFLRDRLKILTPERPGPEAVAAIVAEIADHFPE
AAGTPLGVTFPGVVQNGTVRTAANLPGPWVGTDARALFSQATGRPVRVLNDADAAALAEA
RYGAAKGVLGTVLMTTLGTGIGTALVVDGRLVPNTEFGHLEIDGHDAETRASSGARKRDE
LSYQAWARKRLNRYYRVIEDLLWPDLIVVGGGVSRKADRFLPHLDIRTPIVPATLRNTAG
IVGAALAATEDHARHA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagccgaccacgggcctgggaatcgacatcggcggcagcggtatcaagggggcc
ccggtcgacctggactccggggagttcctccgcgatcgcctcaagatcctcacccccgaa
cgtcccggtcccgaggccgtggcggcgatcgtcgccgagatcgccgaccacttcccggag
gccgcgggcaccccgctcggcgtcaccttccccggcgtggtccagaacgggacggtgcgc
accgccgcgaacctgcccggcccctgggtggggaccgacgcgcgggccctgttctcccag
gccaccgggcggccggtccgcgtgctcaacgacgccgacgccgccgctctggccgaggcc
cgctacggggccgcgaagggcgtactcggcacggtcctgatgacgaccctgggcaccggg
atcggtacggcgctggtggtggacgggcggctggtccccaacaccgagttcggccacctg
gagatcgacgggcacgacgcggagacacgagcctcgtccggcgccaggaaacgggacgag
ttgtcctaccaggcgtgggcccgaaagcgcctgaaccgctactaccgggtgatcgaggac
ctgctgtggcccgacctgatcgtggtcggcggcggggtcagccgcaaggccgaccgtttc
cttccccacctggacatccgcaccccgatcgtgccggcgacgctgcgcaacaccgccggg
atcgtcggcgcggccctggccgcgaccgaggaccacgcccgacacgcctag

DBGET integrated database retrieval system