KEGG   Nocardiopsis alba: B005_4234Help
Entry
B005_4234         CDS       T02218                                 

Definition
FAD binding domain protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nal  Nocardiopsis alba
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nal00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4448302..4449651
Genome map
AA seq 449 aa AA seqDB search
MTGPIDVAVVGAGPAGLATAHALTAAGRSVRVLEAAEAVGGRMRTLRVDGHLVDTGAEMI
PSANAYPATWRLIRELGLDADPSAIPRVRGALSVWWAGRARRNAGRPLGLLTGMGLAPAA
RLDLARLLGRLGGADLDPEHPERGDLTDLSVADLLESAHPQVRERLLGPLASGFFGWPLE
RAAAAPFAAHLVASGSTAHWRTYRDGMDTLPRALADRLDVRTDHPVTRVVEEADGVRLES
PRGDLTARAVVLAVPAPVAMELYPGAAGVERAYLEACEYAPMLRLSLFLDTPMAPRGRGR
GFAVLVSDDPLLSVVTVDHDKHPGRAPRGRGLLSLVASPRGARELAEAPDHEVARRLTES
AERLLPGLGGHVRGAVAHRFRHGLPLPGPKALAARSAFVARPPAAVDYAGDWISLRPCSE
GAVASATTATERVTAFLAAAREPIRIEET
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggaccgatcgacgtggcggtggtgggggcgggcccggccggactggcgacggcg
cacgccctgaccgccgccggacgttcggtgcgggtcctggaggcggccgaggccgtgggc
gggcggatgcgcacgctgcgcgtcgacggccacctggtggacaccggggcggagatgatc
ccgtccgcgaacgcctacccggcgacctggcggctgatccgagagctcggactggacgcc
gacccctcggcgatcccccgggtacgcggcgctctgtcggtgtggtgggcggggcgcgcg
cgtcggaacgcggggcgccctctgggcctgctcaccggtatggggctcgctccggcggcc
cgactggacctggcgcgactgctgggccggctgggcggagccgacctggaccccgaacat
ccggagcggggcgatctgacggacctgagcgtcgccgacctcctggagtcggcgcacccc
caggtacgcgaacgccttctggggccgctggcctcgggcttcttcgggtggccgctggag
cgggcggcggccgcccccttcgcggcccatctggtcgcctcgggcagcaccgcccactgg
cgcacctatcgggacgggatggacaccctgccccgtgccctggccgaccggctcgacgtg
cgcaccgaccatccggtgacccgggtggtcgaggaggcggacggcgtgcgtctggagtcg
ccccgaggcgacctcaccgcccgtgcggtggtcctggcggtgccggcccccgtcgcgatg
gagctgtaccccggggccgcgggtgtggaacgggcctacctggaggcctgcgagtacgcg
ccgatgctccgactgtccctgttcctggacacgccgatggccccgcgcggcagggggcgc
gggttcgccgtcctggtctccgacgaccccctgctgagcgtggtcaccgtcgaccacgac
aaacatcccggccgggcgccccgagggcgtgggctgctctccctggtcgcctctccccga
ggggcccgggagctggccgaggcccccgaccacgaggtggcgcgccggctgaccgagagc
gccgaacgtctcctgcccggcctgggcgggcacgtccgtggagcggtcgcgcaccgcttc
cggcacggactgcccctgcccggcccgaaggcgttggcggcgcgctccgccttcgtcgcc
cgcccgcccgccgccgtcgactacgccggcgactggatctcgctgcgcccgtgcagcgaa
ggcgcggtggcgtcggcgaccacggccaccgaacgggtcacggccttcctggccgccgcc
cgtgaaccgatccgcatcgaggagacatga

DBGET integrated database retrieval system