KEGG   Nocardiopsis alba: B005_4248Help
Entry
B005_4248         CDS       T02218                                 

Definition
zinc-binding alcohol dehydrogenase family protein (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B005_4248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_4248
  Lipid metabolism
   00071 Fatty acid degradation
    B005_4248
  Amino acid metabolism
   00350 Tyrosine metabolism
    B005_4248
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B005_4248
   00626 Naphthalene degradation
    B005_4248
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B005_4248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4465128..4466126
Genome map
AA seq 332 aa AA seqDB search
MDAWAVTRPGPIETGPLERVVRPVPRPRGHEVEIEVLACAVCRTDLHLAEGDLAPRRPGT
VPGHEVVGRVVSQGPDAELYAPGDRVGVAWLASTCGVCAYCRRGDENLCPYSTYTGRHRD
GGFARRLTADERYVHPLPETLPVTTTAPLLCAGVIGYRALQRAEPPERGVLGLYGFGASA
HLTAQVALAQGATVHVMTRSREARELALELGCHSATGAYDPPPEPLSSAILFAPVGDLVP
TALRALDRGGTLAVAGIHLTDIPSLDYRKDLFQERSLRSVTANTRKDARAFLDFAAEHPL
TVTVTTYPFDAADRALADLAADRVRGAAVLLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctgggcggtcacccgccccgggccgatcgagaccggccccctggagcgggtg
gtccggccggttccccggccgcggggacacgaagtggagatcgaggtcctggcctgcgcg
gtgtgccgcaccgacctgcacctggccgagggggacctggcgccccgccgtccgggcacc
gtgcccggccacgaggtggtgggccgggtcgtctcccaaggcccggacgcggagctttac
gcgccgggggaccgggtgggcgtggcctggctcgcctccacctgcggggtctgcgcctac
tgtcggcgcggcgacgagaacctgtgcccgtactccacctacaccggccggcaccgcgac
ggcgggttcgcccgccggctgaccgccgacgaacgctacgtgcacccgctccccgagacc
ctgccggtgacgacgacggcaccgctgctgtgcgccggcgtcatcggataccgggccctt
caacgcgccgaaccaccggagcggggcgtgctcggcctctacgggttcggcgcctcggcc
cacctgaccgcccaggtcgccctcgcccaaggcgcgaccgtccacgtgatgacgcgctcc
cgagaggcgcgggaacttgccctggaactgggctgccactcggcgaccggggcctacgat
ccaccgcccgagccgctctcctccgccatcctcttcgcgcccgtcggggatctggtcccc
acggcgctcagggccctggaccgcggcgggacgctcgctgtggcgggcatccacttgacc
gacatcccctccctggactaccggaaggatctcttccaagagcgttcgctgcgcagcgtg
acggccaatacccgcaaggacgcgcgcgcgttcctcgacttcgccgccgaacacccgttg
accgtgacggtgaccacgtatccgttcgacgccgcggaccgcgccctggccgacctggcg
gccgacagggtacggggcgcggccgtcctgctcccctga

DBGET integrated database retrieval system