KEGG   Nocardiopsis alba: B005_4248Help
Entry
B005_4248         CDS       T02218                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nal  Nocardiopsis alba
Pathway
nal00010  Glycolysis / Gluconeogenesis
nal00071  Fatty acid degradation
nal00350  Tyrosine metabolism
nal00625  Chloroalkane and chloroalkene degradation
nal00626  Naphthalene degradation
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_4248
  Lipid metabolism
   00071 Fatty acid degradation
    B005_4248
  Amino acid metabolism
   00350 Tyrosine metabolism
    B005_4248
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B005_4248
   00626 Naphthalene degradation
    B005_4248
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B005_4248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFR06410
UniProt: J7L4P8
Position
4465128..4466126
Genome map
AA seq 332 aa AA seqDB search
MDAWAVTRPGPIETGPLERVVRPVPRPRGHEVEIEVLACAVCRTDLHLAEGDLAPRRPGT
VPGHEVVGRVVSQGPDAELYAPGDRVGVAWLASTCGVCAYCRRGDENLCPYSTYTGRHRD
GGFARRLTADERYVHPLPETLPVTTTAPLLCAGVIGYRALQRAEPPERGVLGLYGFGASA
HLTAQVALAQGATVHVMTRSREARELALELGCHSATGAYDPPPEPLSSAILFAPVGDLVP
TALRALDRGGTLAVAGIHLTDIPSLDYRKDLFQERSLRSVTANTRKDARAFLDFAAEHPL
TVTVTTYPFDAADRALADLAADRVRGAAVLLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctgggcggtcacccgccccgggccgatcgagaccggccccctggagcgggtg
gtccggccggttccccggccgcggggacacgaagtggagatcgaggtcctggcctgcgcg
gtgtgccgcaccgacctgcacctggccgagggggacctggcgccccgccgtccgggcacc
gtgcccggccacgaggtggtgggccgggtcgtctcccaaggcccggacgcggagctttac
gcgccgggggaccgggtgggcgtggcctggctcgcctccacctgcggggtctgcgcctac
tgtcggcgcggcgacgagaacctgtgcccgtactccacctacaccggccggcaccgcgac
ggcgggttcgcccgccggctgaccgccgacgaacgctacgtgcacccgctccccgagacc
ctgccggtgacgacgacggcaccgctgctgtgcgccggcgtcatcggataccgggccctt
caacgcgccgaaccaccggagcggggcgtgctcggcctctacgggttcggcgcctcggcc
cacctgaccgcccaggtcgccctcgcccaaggcgcgaccgtccacgtgatgacgcgctcc
cgagaggcgcgggaacttgccctggaactgggctgccactcggcgaccggggcctacgat
ccaccgcccgagccgctctcctccgccatcctcttcgcgcccgtcggggatctggtcccc
acggcgctcagggccctggaccgcggcgggacgctcgctgtggcgggcatccacttgacc
gacatcccctccctggactaccggaaggatctcttccaagagcgttcgctgcgcagcgtg
acggccaatacccgcaaggacgcgcgcgcgttcctcgacttcgccgccgaacacccgttg
accgtgacggtgaccacgtatccgttcgacgccgcggaccgcgccctggccgacctggcg
gccgacagggtacggggcgcggccgtcctgctcccctga

DBGET integrated database retrieval system