KEGG   Nocardiopsis alba: B005_4393Help
Entry
B005_4393         CDS       T02218                                 

Definition
O-methyltransferase family protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nal  Nocardiopsis alba
Brite
Enzymes [BR:nal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B005_4393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4602027..4603295
Genome map
AA seq 422 aa AA seqDB search
MPRTSALTPEQARQDMVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDR
HQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGET
GQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPS
WEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPL
LHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADG
WALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPA
GRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANP
FE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgaacatctgccctcacccctgagcaggcgcgccaggacatggtcgacgccctg
gtcgaggagcgagccgacctgggcatggagaaactgcccgagcaggtcgaggaggcactg
cgcgccgtaccacgtgaggtgttcgtgcccggtctgccgttggtcgaggcctatgaccgt
caccaggcgatcgtcaccaaacacgatgaggccaagcgggtggcgctcagctcggtctcg
gccccgagcatcatcgctctcatgctccagcgagccgatatccgcccggggcaccgggtg
ttggagatcggcagcggcggctacaacgcggctctgatctcccatctggtcggcgagacg
gggcaggtgacatcgatcgacatcgatcccgatgtcatcgcgcgcgccgaacggtgcctc
aaggaagccggtgtcgatcaggtgcacttggcggtcaccgacggggagcacggtttcgct
tcccgcgccccctatgaccgcatcatcgtcaccgcgggagcctgggacctgtctccctcg
tgggaagagcagttggcggtgggcggacgtgtggtggtccccatgcgcgtccgtgggctg
acccgctgcttgactctggaacgcgccgaggagccggggcactggcgttccttggccgcg
gacatgtgcgggttcgtgcgcatgcaaggtgtgggggagcactgggagcgcatgccgctg
ctgcaccaggaagagggctctcaggtcgggttgcgcttggaggacggcccccaggtggac
gtcgacgcactgcgccgggcgctgactcaggacggggagaccgtctgggcgggggtgtgc
gtacgcgccgatgagcccaccgatgccttggacctgtacctggcctcggccgccgatggg
tgggctctactgaccgctcagcgcggcgcgatcacgtccaagctgatccgcccggtcgta
ctcatgggtaccccggccatggtcgacgaggagggggagagtttctcctaccgggccctg
cgccgtagccccgatgacgaagagctctacgagttcggggccgtcgagcacggacccgcc
ggccgccgggtcgctcagaacatggtcgatctgatcggtgtgtgggatcgcgagcaccgt
ggtgggccgggcccccgcatcgacctggtgccgatcgacacggcggccgaagacctcccc
acagggcgcgtcgtgtccaaacggcacacccacatgatcctgaactggaccgccaacccc
ttcgagtaa

DBGET integrated database retrieval system