KEGG   Nocardiopsis alba: B005_4430Help
Entry
B005_4430         CDS       T02218                                 

Definition
malonyl-CoA decarboxylase family protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
nal  Nocardiopsis alba
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B005_4430
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B005_4430
Enzymes [BR:nal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     B005_4430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4643045..4644397
Genome map
AA seq 450 aa AA seqDB search
MRPDGARETGPVRPAKEGHDGGPQTADTSGPSALDRLLTDCEILMGDVGEASVRAVAARA
LAAYDELDDPGRTAFFTHVIKDHGVDPDRVRAAFHRWDEAGNSGSGGEEELVELFDAVEP
ARQRLLRRMNHASDATLALVGMRADLRRLMRRHPELRPLDHDLHHLLASWFNRGFLRLAE
VTPDSPRRLHDHLLRYERVHPMADRDALRRRLEPADRRIYAFFHPATGDVPLIFVEVALV
RGTPGDITPLLEPGPALDPREADTAALYSINNALDGLTGISFGDLLIKQVIEQVRDRLPH
LEHFVTLSPIPGFRRWLDERAESEADLRELVRDLDAADGPADLDPADTARIRPRLLPVLA
RYIAAEKRDDGRPLDPVARFHLGNGAAAWRLDWPANPSERAWRQSYGAMVNYRYEPDKLE
RRHEDFVRRRTVALDGPLREALPDAPDSDT
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgacggagcgcgcgagaccggtccggtccgaccggcgaaagagggacacgac
ggtggtccccagacggccgatacatcggggccgtccgccctggaccgcctgctcaccgac
tgcgagatcctcatgggcgacgtgggcgaggcctccgtccgcgcggtcgcggcgcgggcc
ctggccgcctacgacgaactcgacgaccccggcagaacggccttcttcacccacgtcatc
aaggaccacggcgtcgaccccgaccgggtccgcgccgccttccaccgctgggacgaggcc
ggcaacagcggatccggaggcgaggaggagctggtcgagctcttcgacgcggtcgagccg
gcacgccagcgactgctccgccggatgaaccacgcgtccgacgccacgctcgccctggtc
gggatgcgcgcggacctgcgccgactgatgcgccgccatccggaactacgccccctggac
cacgacctccaccacctgctcgcctcctggttcaaccgcggattcctccgcctggcggag
gtcaccccggactcgccccgacggctgcacgaccacctgctgcgctacgagagggtccac
ccgatggcggaccgcgacgcactccgtcgccgtctggagcccgcggaccgccgcatatac
gccttcttccacccggccaccggcgacgtgccgctgatcttcgtggaggtcgccctggtg
cgagggacaccgggcgacatcacccccctgctggagcccggccccgccctggacccccga
gaggccgacacggcggcgctctactcgatcaacaacgctctggacggcctgaccgggatc
tccttcggcgacctcctcatcaagcaggtcatcgagcaggtacgcgaccggctgccccac
ctggagcacttcgtcacgctctcaccgatcccggggttccgacgctggctcgacgagcgg
gccgagagcgaggccgacctgcgggagctcgtccgggacctggacgccgcggacggcccg
gccgacctcgaccccgcggacaccgcgcggatccgcccccggctcctgcccgtcctggcc
cggtacatcgcggccgagaaacgcgacgacggacggcccctcgacccggtcgcccgcttc
cacctgggcaacggggccgccgcgtggaggctcgactggccggcgaacccctcggagcgg
gcctggcggcagtcctacggcgcgatggtcaactaccgctacgagccggacaagctcgaa
cgccgccacgaggacttcgtccgccgccgcaccgtggcgctcgacggccccctgcgggag
gcgctgccggacgccccggactccgacacgtga

DBGET integrated database retrieval system