KEGG   Nocardiopsis alba: B005_4580Help
Entry
B005_4580         CDS       T02218                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nal  Nocardiopsis alba
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nal00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4800573..4801532)
Genome map
AA seq 319 aa AA seqDB search
MNAPIGPTDSSLVPRFAGPATFARLPRIDQVEHADIAVVGVPFDTGVSYRPGARFGPSAI
REASRLLRPYHPGLDVAPFERLQVVDGGDIAVNPFSIGDAVETLDQGASKFVEAGTRLVT
LGGDHTIALPLLRSLYRKHGPIAMLHFDAHLDTWDTYFGEPYTHGTPFRRAVEEGILDTE
AIAHVGTRGPLYGKRDLEDDRRFGFGIVTAVDVLRKGVDEIADALRQRIGNRPLYVSVDI
DVLDPAHAPGTGTPEAGGLTSRELLEILRGLADLNLVGADVVEVAPAYDHAQITSTAASH
VAYDLVSLLALNHRRRSEG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgatcggccccaccgactccagcctcgttccgcgtttcgcgggcccggcg
accttcgcgcgcctgccccgtatcgaccaggtcgagcacgccgacatcgccgtggtcggc
gtccccttcgacaccggtgtgtcctaccgccccggcgcccgtttcggcccctcggcgatc
cgcgaggccagccgactgctgcgcccctaccacccgggtctggacgtggccccgttcgag
cgcctccaggtggtggacggcggcgacatcgccgtgaacccgttctccatcggggacgcg
gtggagaccctggaccagggcgcctcgaagttcgtcgaggccgggacccgcctggtcacc
ctgggcggcgaccacacgatcgcgctgccgctgctgcgctccctgtaccggaagcacggc
ccgatcgcgatgctgcacttcgacgcccacctggacacctgggacacctacttcggcgag
ccctacacccacggcacgcccttccgtcgcgcggtggaggagggcatcctcgacaccgag
gccatcgcgcacgtgggcacgcggggtccgctgtacggcaagcgcgacctggaggacgac
cgccgcttcggcttcggcatcgtcaccgccgtcgacgtcctgcgcaagggcgtggacgag
atcgccgacgcgctgcgtcagcgcatcgggaaccgtccgctgtacgtctcggtggacatc
gatgtcctggacccggcccacgccccgggcaccggcacccccgaggccggcggtctgacc
agccgtgagctgctggagatcctgcgcgggctggccgatctgaacctggtcggcgccgac
gtggtggaggtcgccccggcctacgaccacgcgcagatcacctccaccgccgcctcccac
gtcgcctacgacctggtctccctgttggccctgaaccaccggcggcgttcggagggctga

DBGET integrated database retrieval system