KEGG   Nocardiopsis alba: B005_4699Help
Entry
B005_4699         CDS       T02218                                 

Gene name
phoD
Definition
alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nal  Nocardiopsis alba
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nal00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:nal00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nal02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4917228..4918823
Genome map
AA seq 531 aa AA seqDB search
MPGIPESPDRSPASRIATTRRQALMGGAVTLGAAALGTTLGTSSASAATSTPRGPVISDP
FTLGVASGDPFHNSVVLWTRLAPDPLADDGLGGMPDQTVEVEWQVSQDENFRRIVSSGTV
ETGPDQAHSVHVEAGGLRPRADYFYRFRAAGEISPVGRTRTTTAPGARLERFSFAFASCQ
SYTHGHYTAQGHLADEDLDLVAFLGDYIYETGDQGDIGRGHLPAVEVRSLAEYRIRHAQY
KTDENLQAAHAAFPWAVVFDDHELENNWADDTSYEEDIPSEEFLLRREQALKAYYEHMPL
RAAQRPAGPDLHLYRRLTFGNLVDMHLLDTRQYRDPQVEDTEREDPERTLLGADQRRWLS
RGLSESRATWNVLAQQVFFSQRDFAEGDATNFSDDAWDNYKVERDGVRDELAQVSNPVVI
TGDVHANYVVDVKADFDDPASATVATELVGTSFTSGRDGAEQNPGDAVQLQENPHIKFIN
RRRGYVRNTVTPTEWTADYRVVDKVSSPGAPITDRARFVIESGEAGARPLA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcatccccgaatcccccgaccgctcccccgcgtccaggatcgccaccacccgc
cgtcaggcgctcatgggcggcgcggtcacgttgggagccgcggcactgggtacgactctg
ggcacatcctccgcttcagcggccacctcgacccccagaggccccgtgatcagcgatccc
ttcaccctcggcgtcgcctcaggcgaccccttccacaacagtgtcgtcctatggacccgg
ctggcccccgaccccctggccgatgacggtctgggcggcatgcccgatcagaccgtagag
gtcgaatggcaggtctcccaggacgagaacttccgtcgcatcgtctcctccggcacggtg
gagaccggccccgaccaggcccactcggtccacgtcgaggccgggggcctgcgtccccgc
gccgactacttctaccgcttccgggccgccggcgagatcagccccgtcggccgcacccgg
accaccaccgcccccggcgcccggctggagcgcttctccttcgccttcgccagctgccag
agctacacccacggtcactacaccgcccagggccacctggccgacgaggacctggacctg
gtggccttcctgggcgactacatctacgagaccggcgaccagggcgacatcggtcgcggc
cacctgcccgcggtggaggtccgttccctggccgagtaccggatcaggcacgcccagtac
aagaccgacgagaacctccaggccgcgcacgccgccttcccctgggcggtggtcttcgac
gaccacgagctggagaacaactgggccgacgacacctcctacgaggaggacatccccagt
gaggagttcctgctccgccgcgagcaggcgctcaaggcctactacgagcacatgccgctg
cgcgcggcccagcgtccggccggtcccgacctgcacctgtaccgcaggctgaccttcggc
aacctggtggacatgcatctgctggacacccgccagtaccgggacccgcaggtggaggac
accgaacgggaggaccccgagcgcaccctgctcggcgccgaccagcgccggtggctctcg
cgagggctgtccgagtccagggcgacctggaacgtgctcgcccagcaggtgttcttctcc
cagcgcgacttcgccgagggggacgccaccaacttcagcgacgacgcctgggacaactac
aaggtcgagcgcgacggggtccgggacgagctcgcccaggtgtccaacccggtggtcatc
accggtgacgtgcacgccaactacgtggtcgacgtcaaggccgacttcgacgaccccgca
tcggccacggtcgccaccgagctggtggggacctccttcaccagcggccgggacggggcg
gagcagaacccgggcgacgccgtccagcttcaggagaacccgcacatcaagttcatcaac
cgccgtcgtggctatgtgcgcaacaccgtcacccccaccgagtggaccgccgactatcgg
gtggtcgacaaggtgagctcaccgggtgcgcccatcaccgatcgcgcgcgtttcgtcatc
gagtccggtgaggccggggcccgccctctggcctga

DBGET integrated database retrieval system