KEGG   Nocardiopsis alba: B005_4891Help
Entry
B005_4891         CDS       T02218                                 

Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
nal  Nocardiopsis alba
Pathway
nal00220  Arginine biosynthesis
nal00250  Alanine, aspartate and glutamate metabolism
nal00471  D-Glutamine and D-glutamate metabolism
nal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B005_4891
   00220 Arginine biosynthesis
    B005_4891
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B005_4891
Enzymes [BR:nal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     B005_4891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase Herpes_TK
Motif
Other DBs
NCBI-ProteinID: AFR07822
UniProt: J7LBF6
Position
5089511..5090785
Genome map
AA seq 424 aa AA seqDB search
MRSPILDYLDAIIAQTAHVDSGARADYIPELASADPGRVAVAICTVNGTVYASGDADDLF
SIQSMSKPFAYALAIEDRGIDDILDRVGVEPSGEAFNELSLDPETGRPRNPMINAGAIAV
HALVDDREAPAVDRLLGLFSDLTQRPVEVDEGLAASELATGDRNLGLAYLLHASGRLARD
PAASVEGYVRQCSASVTVRDLALMAATLANGGVQPNTGKQLFSRRTTRHLLSVMASCGMY
DAAGDWLTSVGIPAKSGVAGGIIGVLPGQVGVAVFSPRLDQHGNSARGVVMMEKLSEDLG
LHLMEPGRPSRSSLRETRKEVVEGEPTTIYVLQGDMVLSSIEALVHELVENPPATDVVVF
DMSRVDEVLPVARRTAAETATKMIDGGYRIIVVDPEETVPAFHDSRGRSVERWTSERLEL
ALRS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaccgatcctcgactacctcgacgcgatcatcgcccagaccgcgcacgtcgac
tccggggcccgggccgactacatcccggaactggcctccgccgaccccggccgggtggcg
gtggccatctgcacggtcaacgggaccgtgtacgcgagcggtgacgccgacgacctgttc
agcatccagtcgatgtccaagcccttcgcctacgcgctggcgatcgaggaccggggtatc
gacgacatcctcgaccgggtcggggtggagcccagtggcgaggccttcaacgagctgtcg
ttggaccccgagaccggtcggccgcgcaacccgatgatcaacgcgggcgcgatcgccgtc
cacgcgctcgtcgacgatcgggaggctccggcggtcgaccggctgctcggcctcttctcc
gacctgacccaacggccggtcgaggtcgatgagggtctggccgcctccgagctggcgacc
ggggaccgcaacctggggctcgcgtacctgttgcacgcctcggggcggttggcccgggac
ccggcggcgtcggtggagggctacgtccgtcagtgttcggcgtcggtgaccgtgcgcgac
ctggcgttgatggcggcgaccctggccaacggcggcgtgcagcccaacacgggaaagcag
ttgttcagtaggcgcaccacccgacacctgttgagcgtgatggcctcgtgcggcatgtac
gacgcggccggcgactggctgaccagcgtgggcatccccgccaagagcggcgtggccgga
ggcatcatcggggtgctcccggggcaggtgggcgtcgcggtgttctcaccgcgcctggac
cagcacggcaacagcgcccggggcgtggtgatgatggagaagctgtccgaggatctgggg
ctgcacctgatggagccggggcgtccgtcgcgctcctctctgcgggagacccgcaaggag
gtcgtggagggggaaccgaccacgatctacgtgctccagggcgacatggtgttgagcagt
atcgaggcgctcgtgcacgagctggtcgagaacccgccggcgaccgacgtggtggtcttc
gacatgagccgggtggacgaggtgctgccggtggcgcgcaggaccgcggccgagaccgcc
accaagatgatcgacggcgggtaccggatcatcgtggtcgaccccgaggagaccgtgccg
gccttccacgacagccgggggcgttcggtggagcgttggacctccgaacgcctggagctc
gccctccggagctga

DBGET integrated database retrieval system