KEGG   Nocardiopsis alba: B005_5316Help
Entry
B005_5316         CDS       T02218                                 

Definition
description family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nal  Nocardiopsis alba
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B005_5316
Enzymes [BR:nal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B005_5316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5514462..5516222
Genome map
AA seq 586 aa AA seqDB search
MSEAVEKVSAVLDRMGAPRALAARLVSVLGPQPAAELDADPWLLLRLPGVTLEQADFCAR
HHLGDQARPDDPRRLAALVRHTLRTAAGRGHTAVEEKRLATVIGRLGVPSPMAALEAALS
SEQAVLFESTDEPDDDFDFEEGGIPEPPDPERFYALAEIGEREQRLGVRLARLIGANDPV
MDSLTATETVDAARERGGFPLSEQTREALVTVALRPVTVLRHGPGDRAEIARALLGIAAI
AKESGVGLAVVAPTAQTAAAAEADLASVVDAKGEPDEEGAESAPGVESLPALLARAPIEA
GIVVLYESMAVGTSRMAELVSACSEGAHLVLLADPDQAPSATPGRVAMDVAVSRTAHVAL
LADDAEPGPLAVLAGAVAAGDLPEVEAPGREVVRVPASSAEEAAHRVTQLVTDSIPRALG
VASEGIQVVTAREDGPAGARALNAACKELLNPGPGAHGGFDVGDRILVTAEGPGYGPGDT
GYLREVSEGAVVELAGGSRVKVTDPSVLRHGWAITVAAAHGGLWPAVVAVFPPEVPTSRP
QVYTCLTRATRHVSVVDATDGALATGVRETLAPERTTRLVQILREG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggccgtcgagaaggtcagtgccgtccttgaccgcatgggcgccccgcgcgct
ctggcggcgcggctggtgtccgtactgggtccgcagcccgccgcagagctggacgccgac
ccctggctcctgctccgcctgccgggggtgaccctggaacaggccgacttctgcgcccgc
caccacctgggcgaccaggccagaccggacgatccccgtcgtctggccgcgctggtccgg
cacaccctgcgcaccgcggcggggcgcggccacaccgcggtcgaggagaagcggctcgcc
acggtgatcgggcgactgggcgtcccctcccccatggccgccctggaggcggccctgtcg
agcgagcaggcggtgctgttcgagagcaccgacgaaccggacgacgacttcgacttcgag
gagggcgggatccccgagccgcccgaccccgaacgtttctacgcgctcgccgagatcggt
gagcgcgaacagcgtctgggcgtccgcctggcccggctcatcggcgccaacgatccggtc
atggactcgttgaccgcgaccgagaccgtcgacgccgcccgggagcggggcggcttcccc
ctgtccgaacagacccgtgaggccctggtgacggtggctctgcgcccggtcaccgtgcta
cgacacggccccggtgaccgcgccgagatcgcccgcgccctgctcgggatcgccgccatc
gcgaaggagagcggtgtgggcctggcggtggtcgcccccacggcgcagaccgccgccgcg
gccgaggccgacctggcctccgtggtcgacgcgaagggcgagccggacgaggagggggcg
gagagcgcgcccggcgtggagtcgctacccgccctcctggcccgggccccgatcgaggcg
ggcatcgtggtgctgtacgagtcgatggcggtgggcacctcccgcatggccgagctggtc
tcggcctgctccgagggcgcgcacctggtgctgttggccgaccccgaccaggccccttcg
gccaccccggggcgggtggcgatggacgtcgccgtctcccgtaccgcccacgtggcgctc
ctggccgacgatgccgaaccggggcccctggcggtcttggccggggccgtggccgcagga
gacctgcccgaggtcgaggcccccgggcgcgaggtggtccgagtgccggcctcctccgcg
gaggaggcggcccaccgggtgacccagctggtcaccgactccatcccccgggccctgggc
gtggcctccgaggggattcaggtggtgaccgcccgggaggacggcccggcgggcgcacgc
gcgctcaacgccgcctgcaaggaactgctgaacccggggccgggcgcgcacggcgggttc
gacgtgggagaccggatcctggtgaccgccgaggggccgggatacggccccggggacacc
ggatacctgcgcgaggtgtcggagggcgccgtggtggagctggccggcggttcccgggtg
aaggtgacggacccgtccgtgttgcggcacgggtgggcgatcaccgtggcggccgcacat
ggtgggctgtggcccgccgtggtcgcggtcttcccgcccgaggttccgacctcgcgtcct
caggtgtacacctgcctgacccgcgccacccggcacgtgtcggtggtggacgccaccgac
ggggcgttggcgaccggggtgcgcgagacgctcgcgcccgagcgcaccacccgcctggtc
cagatcctccgcgaaggctga

DBGET integrated database retrieval system