KEGG   Nocardiopsis alba: B005_5573Help
Entry
B005_5573         CDS       T02218                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_5573 (tpiA)
   01230 Biosynthesis of amino acids
    B005_5573 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_5573 (tpiA)
   00051 Fructose and mannose metabolism
    B005_5573 (tpiA)
   00562 Inositol phosphate metabolism
    B005_5573 (tpiA)
Enzymes [BR:nal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B005_5573 (tpiA)
Exosome [BR:nal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B005_5573 (tpiA)
  Exosomal proteins of bladder cancer cells
   B005_5573 (tpiA)
  Exosomal proteins of melanoma cells
   B005_5573 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5809335..5810114)
Genome map
AA seq 259 aa AA seqDB search
MAKRMPLIAGNWKMNNNHLEAIALVQKLAFALNDKDYDNAEVVVLPPFTDIRSVQTLVDG
DKLRIGFGAQDISAHDKGAYTGEISGAMLAKLECSYVLVGHSERREYHNEDDALVNAKVK
AAYKNGIVPILCVGEGLEVRKAGAQVEHVLAQLDGALKEITAEQAEKIVVAYEPVWAIGT
GEVATPEDAQEVCAAIRARLAELYSPEVADAVRVLYGGSVKGDNAPGIMAKADVDGALVG
GACLKADEFAKVIRFRENG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgcatgccgctcatcgcgggcaactggaagatgaacaacaaccacctcgag
gcgatcgcgctggtccagaagctggccttcgccctgaacgacaaggactacgacaacgcc
gaggtcgtcgtcctgcccccgttcaccgacatccgcagcgtgcagacgctggtggacggg
gacaagctgcgcatcggtttcggtgcccaggacatctccgcccacgacaagggcgcctac
accggtgagatctccggtgcgatgctggccaagctggagtgctcctacgtcctggtcggc
cactccgagcgtcgtgaataccacaatgaggacgacgccctggtcaacgccaaggtcaag
gccgcctacaagaacgggatcgtcccgatcctgtgcgtgggcgagggcctggaggtccgc
aaggccggtgcccaggtcgagcacgtcctggcccagctcgacggcgccctgaaggagatc
accgccgagcaggcggagaagatcgtcgtggcctacgagcccgtgtgggccatcggtacc
ggcgaggtcgccacccccgaggacgcccaggaggtctgcgcggcgatccgcgcccgtctg
gccgagctgtactcgcccgaggtcgccgacgcggtgcgcgtcctctacggcggctccgtc
aagggcgacaacgcccccggcatcatggccaaggccgacgtggacggcgccctggtgggc
ggtgcctgcttgaaggcggacgagttcgccaaggtgatccgcttccgcgagaacggctga

DBGET integrated database retrieval system