KEGG   Nautilia profundicola: NAMH_0053Help
Entry
NAMH_0053         CDS       T00860                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nam  Nautilia profundicola
Brite
Enzymes [BR:nam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NAMH_0053
Secretion system [BR:nam02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NAMH_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(44558..45292)
Genome map
AA seq 244 aa AA seqDB search
MKKLLLGLGIAVSLFASDKLLSQKELNNVLKSSIIYPKLSQDIKKGIVKVRGVEKDGFYI
INIKTPRGSGNIYITKDKKYTILGNVLNNKNGTPLTANFPVNKKIVQNGVIFTFGKGDKE
IYLVTDPECPYCRMMEVKTKANLEKNYKVHVILFPLSFHKNAKAMSYYILAGKTDAEKAK
RFREVLGGSNEWKNYHPTKEEKVKFDKILNNSKKAVEELGARGTPTVYDKDFNKINWTTL
GEKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactattattaggtttaggtatagcggtaagtttgtttgcaagcgacaagctt
ttatctcaaaaagaattaaacaatgttttaaaatcaagcataatatatccgaaactttca
caggatatcaaaaaaggaatcgttaaagtaagaggtgttgaaaaagacgggttttatatt
ataaatattaaaacaccgagaggttcagggaacatatacataacaaaagacaaaaaatat
accatcttaggcaatgttttaaataataaaaacggaacacctctaacggcaaattttccg
gtaaataaaaaaatagtacaaaacggtgttattttcacattcggaaaaggtgacaaagaa
atttatcttgtgactgatcctgaatgcccttattgtagaatgatggaagtaaaaacgaaa
gcaaaccttgaaaaaaattataaagtgcatgtaattttattcccgttaagtttccataaa
aacgcaaaagccatgagttattatattttagctgggaaaacggatgcggaaaaagccaaa
agattcagagaagttttaggtggcagcaacgaatggaaaaactaccatcctacaaaagaa
gaaaaagtaaaatttgataaaatattaaataattctaaaaaagcggttgaagaattaggg
gcaagaggtacacctacagtttacgataaagatttcaataaaatcaactggactacattg
ggagagaaaaaatga

DBGET integrated database retrieval system