KEGG   Nautilia profundicola: NAMH_0240Help
Entry
NAMH_0240         CDS       T00860                                 

Definition
(GenBank) pyruvate synthase subunit PorC (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAMH_0240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0240
   00020 Citrate cycle (TCA cycle)
    NAMH_0240
   00620 Pyruvate metabolism
    NAMH_0240
   00640 Propanoate metabolism
    NAMH_0240
   00650 Butanoate metabolism
    NAMH_0240
  Energy metabolism
   00680 Methane metabolism
    NAMH_0240
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NAMH_0240
Enzymes [BR:nam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NAMH_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
207416..207973
Genome map
AA seq 185 aa AA seqDB search
MLQIRWHSRAGQGAVTGAKALADVMARTGKFVQAYSVYGAEKRGAPMTAYDKIADEPILD
HSKWMSPDYVLVIDPSLVYQEEIVDNTTEDTIFIVTTHLPKDELVKIAKHLDGKKLYVID
AIKISQEEIGRAIPNTPMLGAFIKVSQILPFEDFLVSIEDILSKFPQKIIDGNLRAIKRA
YEEVN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaattagatggcactctcgcgcaggacaaggggcagtaacaggtgctaaagca
cttgctgatgttatggcaagaactggaaagttcgttcaagcttattcggtttacggtgca
gaaaaaagaggggcacctatgacagcatatgataagattgctgatgagcctattttagat
cactctaaatggatgagtccggattatgtattggtaatcgacccttctttagtgtatcag
gaagaaatagttgataacacaactgaagacactatatttatagttactacacatttacca
aaagatgagcttgtaaaaattgcaaaacatcttgacgggaaaaaattatacgttattgac
gcaattaaaatttctcaagaggaaatcggaagagcaattccaaatacaccaatgcttgga
gcatttataaaagtttcacaaatattaccttttgaagatttcttagtttcaatcgaagat
attctttcaaaattcccgcaaaaaattattgacggtaacttaagagctattaaaagagct
tacgaagaagtaaattaa

DBGET integrated database retrieval system