KEGG   Nautilia profundicola: NAMH_0241Help
Entry
NAMH_0241         CDS       T00860                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAMH_0241
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0241
   00020 Citrate cycle (TCA cycle)
    NAMH_0241
   00620 Pyruvate metabolism
    NAMH_0241
   00640 Propanoate metabolism
    NAMH_0241
   00650 Butanoate metabolism
    NAMH_0241
  Energy metabolism
   00680 Methane metabolism
    NAMH_0241
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NAMH_0241
Enzymes [BR:nam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NAMH_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
207983..208387
Genome map
AA seq 134 aa AA seqDB search
MATPKEMLTTWDKIQFGAVLPSFEDPEAKKRSKFHSYNYKVADWRVEKPVYNRELCIDCD
FCWVACPDSCFEVEEVVNKRGKKQAKIVGINYNLCKGCGVCVEVCPTPIKSLLMFPEQID
NEEALNQWPKKEDK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctaaagaaatgttaacgacttgggataaaattcaatttggtgcggtttta
ccatcatttgaagatccggaagcaaaaaaaagaagtaaattccattcatataactataaa
gttgcggattggagagttgaaaaacctgtttataatagagaattgtgtattgactgtgat
ttttgttgggttgcatgtcctgatagctgctttgaagtagaagaagtagtaaataaaaga
ggtaaaaagcaggctaaaattgtgggaataaattataatttatgtaaaggatgcggtgta
tgcgtggaagtatgtcctacaccgattaaatctttattaatgttcccagaacaaattgat
aatgaagaggctttaaatcagtggcctaaaaaagaagataaataa

DBGET integrated database retrieval system