KEGG   Nautilia profundicola: NAMH_0241Help
Entry
NAMH_0241         CDS       T00860                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00020  Citrate cycle (TCA cycle)
nam00620  Pyruvate metabolism
nam00633  Nitrotoluene degradation
nam00640  Propanoate metabolism
nam00650  Butanoate metabolism
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
Module
nam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0241
   00020 Citrate cycle (TCA cycle)
    NAMH_0241
   00620 Pyruvate metabolism
    NAMH_0241
   00640 Propanoate metabolism
    NAMH_0241
   00650 Butanoate metabolism
    NAMH_0241
  Energy metabolism
   00680 Methane metabolism
    NAMH_0241
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NAMH_0241
Enzymes [BR:nam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NAMH_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4_6 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_4 Fer4_13 Fer4_16 Fer4_8 Fer4_17 Fer4_22 Fer4_18 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ACM93341
UniProt: B9L7Q7
Position
207983..208387
Genome map
AA seq 134 aa AA seqDB search
MATPKEMLTTWDKIQFGAVLPSFEDPEAKKRSKFHSYNYKVADWRVEKPVYNRELCIDCD
FCWVACPDSCFEVEEVVNKRGKKQAKIVGINYNLCKGCGVCVEVCPTPIKSLLMFPEQID
NEEALNQWPKKEDK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctaaagaaatgttaacgacttgggataaaattcaatttggtgcggtttta
ccatcatttgaagatccggaagcaaaaaaaagaagtaaattccattcatataactataaa
gttgcggattggagagttgaaaaacctgtttataatagagaattgtgtattgactgtgat
ttttgttgggttgcatgtcctgatagctgctttgaagtagaagaagtagtaaataaaaga
ggtaaaaagcaggctaaaattgtgggaataaattataatttatgtaaaggatgcggtgta
tgcgtggaagtatgtcctacaccgattaaatctttattaatgttcccagaacaaattgat
aatgaagaggctttaaatcagtggcctaaaaaagaagataaataa

DBGET integrated database retrieval system