KEGG   Nautilia profundicola: NAMH_0243Help
Entry
NAMH_0243         CDS       T00860                                 

Definition
(GenBank) PorB subunit of pyruvate:flavodoxin oxidoreductase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00020  Citrate cycle (TCA cycle)
nam00620  Pyruvate metabolism
nam00633  Nitrotoluene degradation
nam00640  Propanoate metabolism
nam00650  Butanoate metabolism
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
Module
nam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0243
   00020 Citrate cycle (TCA cycle)
    NAMH_0243
   00620 Pyruvate metabolism
    NAMH_0243
   00640 Propanoate metabolism
    NAMH_0243
   00650 Butanoate metabolism
    NAMH_0243
  Energy metabolism
   00680 Methane metabolism
    NAMH_0243
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NAMH_0243
Enzymes [BR:nam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NAMH_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C RP-C_C
Motif
Other DBs
NCBI-ProteinID: ACM92521
UniProt: B9L7Q9
Position
209627..210580
Genome map
AA seq 317 aa AA seqDB search
MKNIGNLKEFACTPDRFQGGHRLCPGCAHSMIVREVVNATDDDLVISTATGCLEVCTSIY
PYTSWDVSWIHIGFENAAAAIAGAEAMYSALSRKDKLYNDDRKVKFVAFGGDGGTYDIGF
QSLSGAVERGHDFLYVCLDNENYANTGGQRSSATPIGAHTSTTPRGRVSYGEKQKKKDLT
MIMAAHGCPYVATAIPGTKHWKDLATKAAKAISTVGPTFINALSPCTTEWKFKPEETVEI
ADLAVETCAFPLYEIEDGHKLTITYRPKNKIPIEEYLGRQGRFSHLFKPENKWIIEEWQK
NVDAYWEYLQRREEAGV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataggtaatttaaaagaattcgcatgtactcctgatagatttcaaggtggt
catagattatgtccgggatgtgctcatagtatgatagttagagaagtagtaaacgctact
gatgatgatttagttatatcaactgctacagggtgtcttgaagtgtgtacttcaatttat
ccatatacatcatgggacgtttcttggattcatatcggatttgaaaacgcagcagctgct
attgcgggtgcggaagcaatgtacagtgctcttagcagaaaagataaactttataatgat
gatagaaaagtaaaattcgttgcattcggtggtgacggtggtacttatgatatcggattc
caatcactcagcggtgcggttgagagaggacatgattttctttatgtttgtcttgacaat
gaaaactacgcaaacacaggtggacagagaagtagtgcgactccaataggtgcgcataca
tctacaacaccaagaggtagagtaagttatggtgaaaaacaaaagaaaaaagatttaact
atgattatggctgctcacggttgtccttacgttgcaactgctattcctggtacaaaacac
tggaaagatttggcaactaaagcggctaaagctatatcaacagtaggtcctacatttatt
aacgcacttagcccatgtacgactgagtggaaatttaaacctgaagaaactgtagaaatt
gctgatcttgcagttgaaacatgtgcgtttcctctatatgagattgaagatggacacaaa
cttacaattacatacagacctaaaaacaaaattccaattgaagaatatcttggaagacaa
ggaagatttagtcatttatttaaaccagaaaataaatggattattgaagagtggcaaaaa
aatgtggatgcttattgggagtatctacaaagaagagaagaagcgggagtttaa

DBGET integrated database retrieval system