KEGG   Nautilia profundicola: NAMH_0257Help
Entry
NAMH_0257         CDS       T00860                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nam  Nautilia profundicola
Brite
Enzymes [BR:nam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NAMH_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223849..224772
Genome map
AA seq 307 aa AA seqDB search
MRVLTLFILFVLFLHAQNLIEPIPEYIKYNKQKAELGKFLFFDTILSKDKTVSCASCHNP
AEGWADSRKVSIGVSGKKGRIQSPTVLNAVFNFRQFWNGRAKDLKEQINGPVHNSVEMNV
NEKIVEKRLNQNRFYKNLFKKVYHTNKITYDMVVDAIAEFEKTLITPNSKFDLYLKGKIK
LTPLEEKGYVLFKKYGCVTCHNGVNVGGNSFQKMGTIFPIKECIGDRYEISHAKFDKCIY
KVPTLRNVELTAPYFHDGSAKTLEKAVEKMAYNNLGFKINKEDAKAIVAFLKTLTGKIPK
IKIMRKE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttttaacactatttattttatttgttttgtttttacatgcgcaaaaccttata
gaacctatcccagaatatataaaatacaataagcaaaaggcggaacttggaaagttttta
ttttttgacactatattgtctaaagataaaaccgttagttgcgccagttgtcataatccg
gccgagggttgggcggacagcaggaaagtctcaataggtgtctcaggtaaaaagggcagg
atacagtcgccgacggttttaaatgccgtatttaattttagacagttttggaacggacgc
gcaaaagatttaaaagagcaaattaatgggccggtgcataattcggtagaaatgaatgta
aatgaaaaaatagttgaaaaaagattaaatcaaaacaggttttataaaaatttatttaaa
aaagtttatcatacaaataaaataacttatgacatggtagttgatgcgatagctgagttt
gaaaaaacattgataactcctaatagtaaatttgatttgtatttaaaaggaaaaataaaa
ctcactccattagaggagaaagggtatgtgttgtttaaaaaatatggatgtgttacgtgt
cataacggagtaaatgtaggtggcaactcattccagaaaatggggacaattttcccaatt
aaagagtgtataggagacagatacgaaatatctcatgcaaaatttgataaatgtatatat
aaggtacccactcttagaaacgtggaactgaccgctccttattttcatgacggaagtgca
aaaacgcttgaaaaagctgttgaaaaaatggcttataataatcttggttttaaaataaat
aaagaagacgcaaaagccattgtggcttttttaaaaacattaacaggtaaaattccaaaa
attaaaataatgagaaaagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system