KEGG   Nautilia profundicola: NAMH_0464Help
Entry
NAMH_0464         CDS       T00860                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:nam01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nam01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nam00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nam00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nam00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406429..407124
Genome map
AA seq 231 aa AA seqDB search
MIVAANFKMNKTRKEVEEYTKVLDVVNFGNVNVSVFPPCSALISKDYIGVQNAYPAKNGA
YTGEIGLEQIKEFSINKILIGHSERRHILKESQKFIVEKFEFYKNEGFEIYYCIGEPLEV
RKKGIDEVIQYLKAQLVGIDLNYERLIIAYEPVWAIGTGVSASNEEIKETHKEIKKLANR
PLLYGGSVKPENVKDILSIENVDGVLVGSASLDVSNFIKMIEIAKEVQKEK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatagtagcagcgaattttaaaatgaataaaacaagaaaggaagtagaagagtatacc
aaggtattggatgttgttaatttcggtaatgttaatgtatcggtatttcctccgtgcagt
gctttaatcagtaaggattatataggtgtgcaaaacgcttatcctgctaagaacggtgca
tatacgggtgaaatagggcttgaacagataaaagagttttcaataaataaaattttaata
ggacacagtgaaagaagacacattcttaaagagtctcaaaaatttatagtagaaaaattt
gaattttataaaaatgagggatttgagatttattactgtatcggagagcctcttgaagtt
agaaaaaaagggattgatgaggtgattcaatatctaaaagctcagcttgtagggatagat
ttgaattatgaaagattaattattgcatacgaaccggtatgggcgattggtacgggtgta
agtgcttcaaatgaagagataaaagaaacacataaagaaataaaaaagcttgcaaacaga
ccgcttttatatggcggaagcgttaaaccggaaaatgttaaagatattctttctattgag
aatgttgacggagtgcttgtcggaagtgcgagtttggatgtaagtaatttcattaaaatg
atagaaatagcaaaagaagtacaaaaggagaaataa

DBGET integrated database retrieval system