KEGG   Nautilia profundicola: NAMH_0464Help
Entry
NAMH_0464         CDS       T00860                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00051  Fructose and mannose metabolism
nam00562  Inositol phosphate metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
nam01230  Biosynthesis of amino acids
Module
nam_M00002  Glycolysis, core module involving three-carbon compounds
nam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0464 (tpiA)
   00051 Fructose and mannose metabolism
    NAMH_0464 (tpiA)
   00562 Inositol phosphate metabolism
    NAMH_0464 (tpiA)
Enzymes [BR:nam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NAMH_0464 (tpiA)
Exosome [BR:nam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NAMH_0464 (tpiA)
  Exosomal proteins of bladder cancer cells
   NAMH_0464 (tpiA)
  Exosomal proteins of melanoma cells
   NAMH_0464 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACM93633
UniProt: B9L8C4
Position
406429..407124
Genome map
AA seq 231 aa AA seqDB search
MIVAANFKMNKTRKEVEEYTKVLDVVNFGNVNVSVFPPCSALISKDYIGVQNAYPAKNGA
YTGEIGLEQIKEFSINKILIGHSERRHILKESQKFIVEKFEFYKNEGFEIYYCIGEPLEV
RKKGIDEVIQYLKAQLVGIDLNYERLIIAYEPVWAIGTGVSASNEEIKETHKEIKKLANR
PLLYGGSVKPENVKDILSIENVDGVLVGSASLDVSNFIKMIEIAKEVQKEK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatagtagcagcgaattttaaaatgaataaaacaagaaaggaagtagaagagtatacc
aaggtattggatgttgttaatttcggtaatgttaatgtatcggtatttcctccgtgcagt
gctttaatcagtaaggattatataggtgtgcaaaacgcttatcctgctaagaacggtgca
tatacgggtgaaatagggcttgaacagataaaagagttttcaataaataaaattttaata
ggacacagtgaaagaagacacattcttaaagagtctcaaaaatttatagtagaaaaattt
gaattttataaaaatgagggatttgagatttattactgtatcggagagcctcttgaagtt
agaaaaaaagggattgatgaggtgattcaatatctaaaagctcagcttgtagggatagat
ttgaattatgaaagattaattattgcatacgaaccggtatgggcgattggtacgggtgta
agtgcttcaaatgaagagataaaagaaacacataaagaaataaaaaagcttgcaaacaga
ccgcttttatatggcggaagcgttaaaccggaaaatgttaaagatattctttctattgag
aatgttgacggagtgcttgtcggaagtgcgagtttggatgtaagtaatttcattaaaatg
atagaaatagcaaaagaagtacaaaaggagaaataa

DBGET integrated database retrieval system