KEGG   Nautilia profundicola: NAMH_0493Help
Entry
NAMH_0493         CDS       T00860                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nam  Nautilia profundicola
Pathway
nam00900  Terpenoid backbone biosynthesis
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NAMH_0493 (ispE)
Enzymes [BR:nam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NAMH_0493 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACM93231
UniProt: B9L8F3
Position
complement(433580..434317)
Genome map
AA seq 245 aa AA seqDB search
MKIKAHAKVNIFLKIVGHDGFYHLIKSRFMKVENLYDEIEIVEGEKFNIIGDINCALRDN
SVFRSYIELTRAYPDIKKWFIGKEIRIHKNIPEMAGLGGGSSDAAAFLRLVNEMSGLNLS
KKELAEIGKKIGSDVPFFIYDYDSANVYGRGDIVEKYDEDLLNIEVFTPPLECSTPDVYR
EYKERFFNPKDTDFDKKDSLELLNNYSPTELNDLFQPALSLYPDLYKYMDKGFFTGSGSS
FFRVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaagcacatgctaaagtcaatatttttttaaaaatagtaggacacgacggg
ttttatcatttaataaaatcaagatttatgaaagtagaaaatttatatgacgaaatagaa
atagtagaaggtgaaaaattcaatattataggtgatataaactgtgcgcttagagacaac
agtgtatttagatcatatatagaacttacaagagcttatcctgatattaaaaaatggttt
ataggaaaagagatcagaattcataaaaacatcccggaaatggcagggctcggcggaggc
agcagtgatgcggcagcctttttacgactcgtaaatgaaatgagcgggcttaacttatca
aaaaaagagctggctgaaatcggtaaaaaaatcggtagcgatgtaccgtttttcatatat
gattatgacagtgccaatgtatacggcagaggtgatattgtagaaaaatatgatgaagat
cttttaaacatagaagttttcactcctcctctcgaatgttccacacctgatgtttacagg
gaatataaagaaagatttttcaatccgaaagatacggattttgataagaaagattcactg
gagcttttaaacaattattcacctactgaattaaacgatctgtttcaaccggcacttagt
ctttatcctgatttatataaatatatggataagggattttttacgggaagcggaagcagt
tttttcagagtgaaataa

DBGET integrated database retrieval system