KEGG   Nautilia profundicola: NAMH_0493Help
Entry
NAMH_0493         CDS       T00860                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nam  Nautilia profundicola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nam00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433580..434317)
Genome map
AA seq 245 aa AA seqDB search
MKIKAHAKVNIFLKIVGHDGFYHLIKSRFMKVENLYDEIEIVEGEKFNIIGDINCALRDN
SVFRSYIELTRAYPDIKKWFIGKEIRIHKNIPEMAGLGGGSSDAAAFLRLVNEMSGLNLS
KKELAEIGKKIGSDVPFFIYDYDSANVYGRGDIVEKYDEDLLNIEVFTPPLECSTPDVYR
EYKERFFNPKDTDFDKKDSLELLNNYSPTELNDLFQPALSLYPDLYKYMDKGFFTGSGSS
FFRVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaagcacatgctaaagtcaatatttttttaaaaatagtaggacacgacggg
ttttatcatttaataaaatcaagatttatgaaagtagaaaatttatatgacgaaatagaa
atagtagaaggtgaaaaattcaatattataggtgatataaactgtgcgcttagagacaac
agtgtatttagatcatatatagaacttacaagagcttatcctgatattaaaaaatggttt
ataggaaaagagatcagaattcataaaaacatcccggaaatggcagggctcggcggaggc
agcagtgatgcggcagcctttttacgactcgtaaatgaaatgagcgggcttaacttatca
aaaaaagagctggctgaaatcggtaaaaaaatcggtagcgatgtaccgtttttcatatat
gattatgacagtgccaatgtatacggcagaggtgatattgtagaaaaatatgatgaagat
cttttaaacatagaagttttcactcctcctctcgaatgttccacacctgatgtttacagg
gaatataaagaaagatttttcaatccgaaagatacggattttgataagaaagattcactg
gagcttttaaacaattattcacctactgaattaaacgatctgtttcaaccggcacttagt
ctttatcctgatttatataaatatatggataagggattttttacgggaagcggaagcagt
tttttcagagtgaaataa

DBGET integrated database retrieval system