KEGG   Nautilia profundicola: NAMH_0681Help
Entry
NAMH_0681         CDS       T00860                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nam  Nautilia profundicola
Pathway
nam00260  Glycine, serine and threonine metabolism
nam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01130  Biosynthesis of antibiotics
nam01230  Biosynthesis of amino acids
Module
nam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_0681 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAMH_0681 (trpA)
Enzymes [BR:nam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NAMH_0681 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACM93751
UniProt: B9L8Y4
Position
complement(604082..604804)
Genome map
AA seq 240 aa AA seqDB search
MKKLISYVTTGYPDKNFTIDLIYTLKESGSDAIELGIPFSDPVADGPVIQEANKRALELG
FKLNDVFEVSQKVGNDIDTYWMGYFNNFYHKGYDFMVQKAQNAGVKGFIIPDLPYEEAVT
YEDIFPLISFVAPTDSKERIKTILKNPKEFIYMVAYAGITGADKQEDLSEIINTVKEITA
TPLYIGFGVNEKTAREKSKGVDGVIVGSAFIKVLLEDISNTEKLKKISQIAKTIKEEINS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatttcatacgtaacaacaggatatcctgataaaaattttaccattgat
ttgatttataccttaaaagaatccggaagcgacgctattgagcttggtattccattttca
gacccggttgccgacggtcctgtaattcaagaagccaacaaaagagctcttgaacttgga
tttaaattaaacgatgtatttgaagtaagccaaaaagtaggaaacgatatagatacttat
tggatgggatactttaacaatttttaccacaaaggatatgattttatggttcaaaaggca
caaaacgcaggtgttaaaggatttattattccggatcttccatatgaagaggccgtaact
tatgaagatatttttcctttaatatcttttgtggcaccaaccgattctaaagaaagaata
aaaactatacttaaaaatcctaaagagtttatatatatggtagcatatgctggaattacg
ggagcagataaacaagaagatttaagtgaaatcataaacacagtcaaagaaattactgct
acacctttgtatataggcttcggtgtaaatgaaaaaaccgcacgtgaaaaatcaaaaggc
gttgacggggtaattgtcggaagcgcatttataaaagtacttcttgaagatataagcaac
actgaaaagctgaaaaaaatttctcaaatagccaaaacaataaaagaggaaatcaactca
taa

DBGET integrated database retrieval system