KEGG   Nautilia profundicola: NAMH_0713Help
Entry
NAMH_0713         CDS       T00860                                 

Definition
ATP-citrate synthase (ATP-citrate (pro-S-)-lyase) (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
nam  Nautilia profundicola
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAMH_0713
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAMH_0713
Enzymes [BR:nam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     NAMH_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
637499..638833
Genome map
AA seq 444 aa AA seqDB search
MAQKPIREYDGKKLFAQNWDKYFSGLNYPFESVLVTSGDELRAKAKEPGYEWLNEKPLVA
KPDMLFGKRGKNNLVLFKVNKPGDVTLEDAAKWIDEKRSGKVTLLSGQSGELTHFIVEPF
TPHSEDEEYYIAATTFDEVNDVLYLSAHGGMEVEENWDKVTEVKIPIDASDEEIEKLVKE
NIPADIPADKKDVYANFAINFYKFFRDLNFAYLEINPVVIVGNNVYLLDLVARLDDTAGF
MMKDKWGDIEFPTPFGMPEKSPEEKAIAEADAKSGASLKLTILNPKGRIWTLVAGGGASV
VYADTIADMAGGVEDLANYGEYSGGPTTDETRFYTETVLDLMTREKDPKGRDKILIIGGA
IANFTDVAKTFTGIIQAFEKYADKMKDVGTRIYVRRGGPNYEKGLKDIKAAAERLGLPIE
VYGPETHITDIVRMALEEDKKGAN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaaccgattcgtgaatatgacggaaaaaaactttttgcccaaaattgggat
aaatattttagcggacttaactatccgtttgaaagtgttcttgttacaagtggagatgag
ttaagagcaaaagcaaaagaaccaggatatgagtggttaaatgaaaaacctttagttgct
aagccagatatgctgtttggtaaaagaggtaaaaacaacttagttttatttaaagttaac
aaacctggagatgttactttagaagatgcggctaaatggattgatgaaaaaagaagcggt
aaagtaacacttcttagcggacaaagcggtgagctgactcactttatcgtagagcctttc
acacctcatagtgaagatgaagagtattacattgcggctacaactttcgatgaagtaaac
gatgtattatacctttcagctcatggtggtatggaagttgaagaaaactgggataaagtt
actgaagtaaaaattcctatcgatgcaagtgacgaagaaatcgaaaaacttgtaaaagaa
aatatccctgcagacattcctgctgacaaaaaagacgtatatgcaaactttgcaattaat
ttctacaaattctttagagatctaaactttgcatatcttgaaattaaccctgtagttatc
gtaggaaacaatgtttatctacttgaccttgttgcaagattagacgatactgccggattt
atgatgaaagacaaatggggtgatatcgaattcccaacaccattcggaatgcctgaaaaa
tcacctgaagaaaaagctattgcagaagcagatgcaaaaagtggtgcttcacttaaactt
acaattcttaaccctaaaggtagaatctggacacttgtagccggtggtggtgcttcagtt
gtttatgctgatactattgctgatatggctggtggagttgaagatttagcaaactatgga
gaatattctggtggtccgactactgatgaaacaagattctatactgaaacagtacttgat
ttaatgacaagagaaaaagacccaaaaggtagagataaaatcttaatcattggtggtgcg
attgcaaactttacagacgtagcaaaaacatttacaggtattatccaagcatttgaaaaa
tatgctgataaaatgaaagatgttggaacaagaatttacgtaagaagaggtggaccaaac
tacgaaaaaggtttaaaagatattaaagcggcagctgaaagacttggacttcctattgaa
gtttacggaccagaaactcacattactgatatcgtaagaatggcacttgaagaagataaa
aaaggagcgaactaa

DBGET integrated database retrieval system