KEGG   Nautilia profundicola: NAMH_0770Help
Entry
NAMH_0770         CDS       T00860                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00020  Citrate cycle (TCA cycle)
nam00620  Pyruvate metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
Module
nam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0770
   00020 Citrate cycle (TCA cycle)
    NAMH_0770
   00620 Pyruvate metabolism
    NAMH_0770
Enzymes [BR:nam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NAMH_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding DnaJ-X HlyD_D23 Glutaredoxin CAT RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACM92443
UniProt: B9L965
Position
complement(698926..700131)
Genome map
AA seq 401 aa AA seqDB search
MEYKVTMPILSDTMDKGKITKWYVKAGDFVKKGDKLCEVESDKAVMDIESFEEGVVKEIL
VKEGEEVPVKSVIAIIETMENGKLTMENEEKKEPENEKPKPKQPEEKNEINLDDIINSIV
SKPKSEIKGTASPAAKKEAARFGIDIEKLQENNKIPKPAHIKDIKEHIISRYFTPKAVKL
LKEYNIEYDMFKLDHKIDSEEVLNYIKQNNIPKITPLTPNQLAVIKNLQNSLTKPTFFVF
EEIEITKKEGIKLTALILKALANAMQKNPLTRTVLQNDTLLTFPSSNISVAVSREDGLFM
CVIKNAEQKDLNEINEWLKEIKSKRLSVEDLSGSTFGVSNLGMFDIERFTALINDKDAGI
AAFGKLSGGKIKVSFTFDHRILNGTDAAVFVNSFKEEIKNV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaagtaacgatgccgattctaagcgatacgatggataaaggtaaaatcaca
aaatggtacgttaaagcaggcgatttcgtaaaaaaaggcgataaactctgcgaagtggaa
agcgacaaagcggttatggatattgagagttttgaagaaggggttgtaaaagaaatcctc
gtaaaagaaggagaggaagttccggtaaaaagcgtaattgctataattgaaacaatggaa
aatggaaaattgacaatggaaaatgaagaaaaaaaagagcctgaaaatgaaaaaccaaag
ccgaaacaacccgaagaaaaaaacgaaataaatttagacgatataataaattcaattgtt
tcaaaaccgaaaagtgaaatcaaaggcacggcatcaccggcggcaaaaaaagaagccgcc
agattcggaatcgatatagaaaaactgcaagaaaataataaaatcccaaaaccggcacat
attaaagatataaaagagcatataatcagcagatattttactccaaaagccgtaaaactg
cttaaagaatacaacattgaatacgacatgttcaaactcgatcataaaattgacagtgaa
gaggtattaaactatattaaacaaaacaacatcccaaaaattactcccctaaccccaaat
cagcttgcggttattaaaaatcttcaaaattccctgaccaaaccgacgtttttcgtattt
gaagaaatagaaatcacaaaaaaagaaggtataaaactaaccgccttaattttaaaagca
ctcgcaaacgccatgcagaaaaatccgcttacacgcaccgtcttacaaaacgacacactt
ttaactttcccctcctccaatatatccgtagcagtaagcagggaagacgggctttttatg
tgcgtaatcaaaaacgccgagcaaaaagatctaaatgaaataaacgaatggttaaaagag
ataaaaagcaaaagattaagcgttgaagaccttagcggttcgactttcggggtgagtaat
cttggaatgtttgatattgaacgttttacggctcttatcaacgacaaagacgcagggatt
gcagcttttggaaaattaagcggaggaaaaataaaggtcagcttcacgtttgatcacaga
atactaaacggaacagatgccgcggtgtttgttaacagttttaaagaggagataaaaaat
gtatga

DBGET integrated database retrieval system