KEGG   Nautilia profundicola: NAMH_0775Help
Entry
NAMH_0775         CDS       T00860                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00030  Pentose phosphate pathway
nam00051  Fructose and mannose metabolism
nam00052  Galactose metabolism
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
nam01230  Biosynthesis of amino acids
nam03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0775
   00030 Pentose phosphate pathway
    NAMH_0775
   00051 Fructose and mannose metabolism
    NAMH_0775
   00052 Galactose metabolism
    NAMH_0775
  Energy metabolism
   00680 Methane metabolism
    NAMH_0775
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NAMH_0775
Enzymes [BR:nam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NAMH_0775
Protein phosphatases and associated proteins [BR:nam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NAMH_0775
Messenger RNA biogenesis [BR:nam03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NAMH_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACM92998
UniProt: B9L970
Position
complement(704359..705321)
Genome map
AA seq 320 aa AA seqDB search
MNIAILTSGGDSSGMNPAIKKFVEYSYLKNHTPYFIYDGLEGLIEGKIKKASFKDVSGII
FRGGTIIRSSRSKRWYEKTYRKQAYENLKKHGIDALVILGGDGSFRALDVFYKDFKVPFM
GIPATIDNDIPLNDYTIGTDTALNVIRHAIDEIRDTASSFARAFVIEVMGRECGYLALTS
AVANGAEMCLIPEVEYSLENLKKRYLNEIKNGRGYFIAIVAEGLKITDKIKEWFEKEIGF
EARSTILGHIQRGGSPTVFERLTAAEFIVKAIDHIESSPDKIVTHKNGEFILKDLNEIIT
SKYALNPEMLKIAAPLMGKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagccatacttacaagcggaggagacagcagcggtatgaaccctgcgattaaa
aagtttgtcgaatattcatatttaaaaaaccatacgccctactttatatacgacggactc
gaaggattgatcgaaggaaaaataaaaaaagcctctttcaaagacgtctcaggcataata
ttcagaggcgggacgataatcagatcgagcagaagcaaaagatggtatgaaaaaacatat
agaaaacaggcttacgaaaacctcaaaaagcacggtatcgacgcacttgtaatcttaggg
ggagacggcagtttcagagcgcttgacgttttttataaagattttaaagtgccgtttatg
ggtatccccgcaacaatcgacaacgatataccgcttaacgattatacaataggcaccgac
accgccttaaacgtaatacgccacgcaatagacgaaataagagacaccgcaagttcgttt
gcaagggcttttgtaattgaagtaatgggaagggaatgcggatatctcgcgctcacaagt
gcggtagccaacggagcggaaatgtgtttgattccggaagttgaatacagccttgaaaat
ctcaaaaaaagatacttaaacgaaattaaaaacggcagggggtattttatcgccattgtt
gcagaaggtttgaaaataaccgataaaatcaaagagtggtttgaaaaagaaataggattt
gaagcaagaagcacaatactcggacacatccaaagaggcggttcgcctaccgtgtttgaa
agactcacagccgccgaatttatcgtaaaagcaatagatcacatcgaaagttcgcccgat
aagatcgttacacataaaaacggagagtttatactaaaagatctaaatgaaataataact
tcaaaatacgcactaaaccccgaaatgctgaaaatcgcggcacctcttatgggaaaggaa
taa

DBGET integrated database retrieval system