KEGG   Nautilia profundicola: NAMH_0775Help
Entry
NAMH_0775         CDS       T00860                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAMH_0775
   01230 Biosynthesis of amino acids
    NAMH_0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0775
   00030 Pentose phosphate pathway
    NAMH_0775
   00051 Fructose and mannose metabolism
    NAMH_0775
   00052 Galactose metabolism
    NAMH_0775
  Energy metabolism
   00680 Methane metabolism
    NAMH_0775
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NAMH_0775
Enzymes [BR:nam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NAMH_0775
Protein phosphatases and associated proteins [BR:nam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NAMH_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(704359..705321)
Genome map
AA seq 320 aa AA seqDB search
MNIAILTSGGDSSGMNPAIKKFVEYSYLKNHTPYFIYDGLEGLIEGKIKKASFKDVSGII
FRGGTIIRSSRSKRWYEKTYRKQAYENLKKHGIDALVILGGDGSFRALDVFYKDFKVPFM
GIPATIDNDIPLNDYTIGTDTALNVIRHAIDEIRDTASSFARAFVIEVMGRECGYLALTS
AVANGAEMCLIPEVEYSLENLKKRYLNEIKNGRGYFIAIVAEGLKITDKIKEWFEKEIGF
EARSTILGHIQRGGSPTVFERLTAAEFIVKAIDHIESSPDKIVTHKNGEFILKDLNEIIT
SKYALNPEMLKIAAPLMGKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagccatacttacaagcggaggagacagcagcggtatgaaccctgcgattaaa
aagtttgtcgaatattcatatttaaaaaaccatacgccctactttatatacgacggactc
gaaggattgatcgaaggaaaaataaaaaaagcctctttcaaagacgtctcaggcataata
ttcagaggcgggacgataatcagatcgagcagaagcaaaagatggtatgaaaaaacatat
agaaaacaggcttacgaaaacctcaaaaagcacggtatcgacgcacttgtaatcttaggg
ggagacggcagtttcagagcgcttgacgttttttataaagattttaaagtgccgtttatg
ggtatccccgcaacaatcgacaacgatataccgcttaacgattatacaataggcaccgac
accgccttaaacgtaatacgccacgcaatagacgaaataagagacaccgcaagttcgttt
gcaagggcttttgtaattgaagtaatgggaagggaatgcggatatctcgcgctcacaagt
gcggtagccaacggagcggaaatgtgtttgattccggaagttgaatacagccttgaaaat
ctcaaaaaaagatacttaaacgaaattaaaaacggcagggggtattttatcgccattgtt
gcagaaggtttgaaaataaccgataaaatcaaagagtggtttgaaaaagaaataggattt
gaagcaagaagcacaatactcggacacatccaaagaggcggttcgcctaccgtgtttgaa
agactcacagccgccgaatttatcgtaaaagcaatagatcacatcgaaagttcgcccgat
aagatcgttacacataaaaacggagagtttatactaaaagatctaaatgaaataataact
tcaaaatacgcactaaaccccgaaatgctgaaaatcgcggcacctcttatgggaaaggaa
taa

DBGET integrated database retrieval system