KEGG   Nautilia profundicola: NAMH_0880Help
Entry
NAMH_0880         CDS       T00860                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAMH_0880
   01230 Biosynthesis of amino acids
    NAMH_0880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0880
  Energy metabolism
   00680 Methane metabolism
    NAMH_0880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_0880
Enzymes [BR:nam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAMH_0880
Exosome [BR:nam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAMH_0880
  Exosomal proteins of melanoma cells
   NAMH_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805120..805809
Genome map
AA seq 229 aa AA seqDB search
MAKLVLVRHGKSEWNKQNRFTGWVDVDLAPEGIEEAKKAGQKLKEAGFCFDICFSSYLKR
AIKTGIIILEELDLLFIDHLKDWRFNERHYGALTGLNKDEVKAEVGEEKFLLYRRSYDVP
PPPLSEDDKRHPRFDPHYKNFPVELLPNTESLKDNQIRAMAAFHERVAPLLVEGKDVLIT
AHGNTIRGMVKELDGISDEDIPKFEIATGIPRVYEFDEALHIKNVYNID
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacttgtacttgttagacatggaaaaagcgaatggaataaacaaaacagattc
acagggtgggttgatgttgatttggcacctgaagggatagaagaagcgaaaaaagcagga
caaaaattgaaagaagcaggtttttgttttgatatatgtttttcttcatatttaaaaaga
gctatcaaaacgggaattataattcttgaggaacttgacttactgtttatagaccatctt
aaagactggagatttaacgaaagacattacggagctcttacagggcttaataaagacgaa
gttaaagccgaagttggtgaagaaaaatttcttctttacagaagaagttacgatgtgccg
cctccgccgctgagcgaagatgacaaaagacatccgagattcgaccctcattataaaaat
tttccggttgaattattgcctaacactgaaagtttaaaagacaatcagataagagcaatg
gcggcttttcatgaaagagtggcacctttacttgtagaaggaaaagacgtgcttattact
gctcacggtaatacaatcagaggtatggtaaaagaacttgacggaattagtgacgaagat
attccaaaatttgaaatcgctactgggattccaagggtttatgagtttgatgaagcttta
catatcaaaaacgtatataatatagactaa

DBGET integrated database retrieval system