KEGG   Nautilia profundicola: NAMH_0880Help
Entry
NAMH_0880         CDS       T00860                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00260  Glycine, serine and threonine metabolism
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
nam01230  Biosynthesis of amino acids
Module
nam_M00002  Glycolysis, core module involving three-carbon compounds
nam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_0880
  Energy metabolism
   00680 Methane metabolism
    NAMH_0880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_0880
Enzymes [BR:nam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAMH_0880
Membrane trafficking [BR:nam04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NAMH_0880
Exosome [BR:nam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAMH_0880
  Exosomal proteins of melanoma cells
   NAMH_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACM93064
UniProt: B9L9H5
Position
805120..805809
Genome map
AA seq 229 aa AA seqDB search
MAKLVLVRHGKSEWNKQNRFTGWVDVDLAPEGIEEAKKAGQKLKEAGFCFDICFSSYLKR
AIKTGIIILEELDLLFIDHLKDWRFNERHYGALTGLNKDEVKAEVGEEKFLLYRRSYDVP
PPPLSEDDKRHPRFDPHYKNFPVELLPNTESLKDNQIRAMAAFHERVAPLLVEGKDVLIT
AHGNTIRGMVKELDGISDEDIPKFEIATGIPRVYEFDEALHIKNVYNID
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacttgtacttgttagacatggaaaaagcgaatggaataaacaaaacagattc
acagggtgggttgatgttgatttggcacctgaagggatagaagaagcgaaaaaagcagga
caaaaattgaaagaagcaggtttttgttttgatatatgtttttcttcatatttaaaaaga
gctatcaaaacgggaattataattcttgaggaacttgacttactgtttatagaccatctt
aaagactggagatttaacgaaagacattacggagctcttacagggcttaataaagacgaa
gttaaagccgaagttggtgaagaaaaatttcttctttacagaagaagttacgatgtgccg
cctccgccgctgagcgaagatgacaaaagacatccgagattcgaccctcattataaaaat
tttccggttgaattattgcctaacactgaaagtttaaaagacaatcagataagagcaatg
gcggcttttcatgaaagagtggcacctttacttgtagaaggaaaagacgtgcttattact
gctcacggtaatacaatcagaggtatggtaaaagaacttgacggaattagtgacgaagat
attccaaaatttgaaatcgctactgggattccaagggtttatgagtttgatgaagcttta
catatcaaaaacgtatataatatagactaa

DBGET integrated database retrieval system