KEGG   Nautilia profundicola: NAMH_0916Help
Entry
NAMH_0916         CDS       T00860                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nam  Nautilia profundicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NAMH_0916 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_0916 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAMH_0916 (trpB)
Enzymes [BR:nam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NAMH_0916 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
842052..843251
Genome map
AA seq 399 aa AA seqDB search
MYIPKPIFDPDERGHFDKFGGRYVPETLMPVLLELEEFYNSVRFDKEFWKEMDYYFKEYI
GRPSPLYFAENLSNELNAKVYLKREDLNHTGAHKVNNTIAQVLLAKKMGKKRVIAETGAG
QHGVATATAAALFGLECEVFMGEKDVKRQELNVFRMKLLGAKVHAVKSGSRTLKDAMNEA
IRYWVTNARDTFYVIGTVAGPHPYPMMVRDFQAIIGYEAKAQILNKENRLPDYVIACIGG
GSNAMGIFSHFLEEEGVQCIGIEAGGMGVETDKHGASLLKGAPGVLHGQMSYLLQDEDGQ
IKEAYSISAGLDYPGIGPEHAFHFEKGNVKYDYITDKEALDAFVWLSQKEGIIPAFESSH
AVAYLKKLKDIENKLVIVNLSGRGDKDMIQAKNILHFED
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtatattccaaaacctatatttgacccggacgaaagagggcattttgacaaattcgga
gggcgttatgttcctgaaacgctaatgccagtacttttagaacttgaagaattttataac
agcgtccgtttcgataaggaattctggaaagaaatggactattattttaaagaatatatc
ggccgtccttcaccactttattttgcggaaaatctcagtaacgaattaaacgcaaaagtt
tatttaaaaagagaagatttaaatcacacaggagcacataaagtaaacaatactatcgct
caggtacttcttgctaaaaaaatgggcaaaaaaagagtaatagccgaaaccggagccgga
cagcacggtgtggccacggctactgctgctgctcttttcggactcgaatgcgaagtgttt
atgggagaaaaagacgtcaagagacaggaactcaatgtattcagaatgaaactgcttgga
gctaaagtacacgccgttaaaagtggaagcagaacgcttaaagacgctatgaacgaagca
atcagatactgggtaaccaatgcaagagacacattctacgttatcggaactgtggccggt
cctcatccgtatcctatgatggtaagggattttcaggcgattatcggatatgaggcaaaa
gctcagatactaaataaagaaaacaggcttcctgattatgtaatagcatgtattgggggc
ggaagtaacgcaatgggaattttttctcactttcttgaagaagagggtgttcagtgtata
ggtatcgaagccggaggtatgggtgttgaaacggataaacacggagccagccttcttaaa
ggtgcacctggagtacttcacggtcaaatgagctaccttctccaagatgaagacggacag
ataaaagaagcatattctatttcagccggtcttgattatccgggtataggtcctgaacat
gcgtttcattttgaaaaaggcaatgtaaaatacgattatattacggataaagaagcactg
gatgcatttgtttggctttcacaaaaagaaggtattattccggcttttgaaagctctcat
gcagtcgcctaccttaaaaaacttaaagacatagaaaacaaacttgtaatcgtaaacctc
tccggacgcggtgataaggatatgatccaagcaaaaaacatcttacattttgaggattga

DBGET integrated database retrieval system