KEGG   Nautilia profundicola: NAMH_0916Help
Entry
NAMH_0916         CDS       T00860                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nam  Nautilia profundicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nam01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nam00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nam00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
842052..843251
Genome map
AA seq 399 aa AA seqDB search
MYIPKPIFDPDERGHFDKFGGRYVPETLMPVLLELEEFYNSVRFDKEFWKEMDYYFKEYI
GRPSPLYFAENLSNELNAKVYLKREDLNHTGAHKVNNTIAQVLLAKKMGKKRVIAETGAG
QHGVATATAAALFGLECEVFMGEKDVKRQELNVFRMKLLGAKVHAVKSGSRTLKDAMNEA
IRYWVTNARDTFYVIGTVAGPHPYPMMVRDFQAIIGYEAKAQILNKENRLPDYVIACIGG
GSNAMGIFSHFLEEEGVQCIGIEAGGMGVETDKHGASLLKGAPGVLHGQMSYLLQDEDGQ
IKEAYSISAGLDYPGIGPEHAFHFEKGNVKYDYITDKEALDAFVWLSQKEGIIPAFESSH
AVAYLKKLKDIENKLVIVNLSGRGDKDMIQAKNILHFED
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtatattccaaaacctatatttgacccggacgaaagagggcattttgacaaattcgga
gggcgttatgttcctgaaacgctaatgccagtacttttagaacttgaagaattttataac
agcgtccgtttcgataaggaattctggaaagaaatggactattattttaaagaatatatc
ggccgtccttcaccactttattttgcggaaaatctcagtaacgaattaaacgcaaaagtt
tatttaaaaagagaagatttaaatcacacaggagcacataaagtaaacaatactatcgct
caggtacttcttgctaaaaaaatgggcaaaaaaagagtaatagccgaaaccggagccgga
cagcacggtgtggccacggctactgctgctgctcttttcggactcgaatgcgaagtgttt
atgggagaaaaagacgtcaagagacaggaactcaatgtattcagaatgaaactgcttgga
gctaaagtacacgccgttaaaagtggaagcagaacgcttaaagacgctatgaacgaagca
atcagatactgggtaaccaatgcaagagacacattctacgttatcggaactgtggccggt
cctcatccgtatcctatgatggtaagggattttcaggcgattatcggatatgaggcaaaa
gctcagatactaaataaagaaaacaggcttcctgattatgtaatagcatgtattgggggc
ggaagtaacgcaatgggaattttttctcactttcttgaagaagagggtgttcagtgtata
ggtatcgaagccggaggtatgggtgttgaaacggataaacacggagccagccttcttaaa
ggtgcacctggagtacttcacggtcaaatgagctaccttctccaagatgaagacggacag
ataaaagaagcatattctatttcagccggtcttgattatccgggtataggtcctgaacat
gcgtttcattttgaaaaaggcaatgtaaaatacgattatattacggataaagaagcactg
gatgcatttgtttggctttcacaaaaagaaggtattattccggcttttgaaagctctcat
gcagtcgcctaccttaaaaaacttaaagacatagaaaacaaacttgtaatcgtaaacctc
tccggacgcggtgataaggatatgatccaagcaaaaaacatcttacattttgaggattga

DBGET integrated database retrieval system