KEGG   Nautilia profundicola: NAMH_0927Help
Entry
NAMH_0927         CDS       T00860                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nam  Nautilia profundicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NAMH_0927 (recR)
DNA repair and recombination proteins [BR:nam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NAMH_0927 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(852713..853276)
Genome map
AA seq 187 aa AA seqDB search
MKDLHSINRLIEAFEELPSIGKKSATRLALSIAKDKFKALKLINAIEDVVANIKECEICG
NFSEHEICDICASENRDKTLAIVENSKDIMIIEESGSYNGYYFVLTHIDDEVIQKLREII
KDKEIKEVIFAFPPSVESEARSLYIEDKLKDLNIEFTQIAQGVPTGVHFENVDVNSLAKA
IKLRFKL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacactcaatcaacagacttattgaagcttttgaggagctgccgagtata
ggtaaaaaatcggcaacaagacttgccctttccattgcaaaagacaaatttaaagcctta
aaacttattaacgcaatagaagatgtggttgcgaatattaaagaatgcgaaatttgtggt
aatttcagtgagcacgaaatctgcgacatatgtgcgtctgaaaacagagataaaacactc
gcaatagtagagaattcaaaagatattatgattatagaagaatccggaagttataacgga
tattattttgtattaactcatatcgacgatgaggttatacaaaaattaagggaaattatt
aaagataaagaaataaaagaagttatatttgcttttccaccgtcggtggagtcggaagcg
agaagcctttatattgaagataaactaaaagatttaaatatagaattcacgcaaatagca
cagggagttccgacgggcgttcattttgaaaatgtagacgtaaactctcttgcaaaagct
attaagcttagattcaagctttaa

DBGET integrated database retrieval system