KEGG   Nautilia profundicola: NAMH_0946Help
Entry
NAMH_0946         CDS       T00860                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nam  Nautilia profundicola
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nam03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(864006..864560)
Genome map
AA seq 184 aa AA seqDB search
MIAALRGNIFEKDGGKILLDVNNVIYELNVSMITFSSVNDKGLFYITEIIKENEYTLYGF
ADKNEKKLFDSLIKLNGVGPKVALAICSTYTPQTFMDIIANHDINALKKIPGIGPKSAKR
ILMEMGEFEVVFEEQNPVFNQALSALESLGFNKNDIVKALNGIKSDNLEETIKLALKKLS
KDIK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcttagaggtaatatttttgaaaaagacggcggcaaaattctgctggat
gtaaataatgtaatttatgaacttaatgtcagtatgattactttttcttcggtaaatgat
aagggacttttttatattaccgagattatcaaggaaaatgaatatacattatacggtttt
gcggataagaatgaaaaaaaactgtttgattctttaataaagcttaacggagtagggcca
aaagtcgctcttgcaatatgttcaacttataccccacagacatttatggatataattgcg
aatcatgatataaacgctcttaaaaagataccaggaataggacctaaaagtgctaaaaga
atattaatggaaatgggtgaatttgaggttgtgtttgaagaacaaaaccctgtatttaat
caagcactcagtgcacttgaaagtttaggatttaacaaaaacgatatagttaaagcctta
aacggtatcaagagcgataatttagaagaaactataaagttagcattaaaaaaactgagt
aaggatataaaatga

DBGET integrated database retrieval system