KEGG   Nautilia profundicola: NAMH_1011Help
Entry
NAMH_1011         CDS       T00860                                 

Gene name
acsA
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nam  Nautilia profundicola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nam01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nam00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nam00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nam00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nam00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928460..930415
Genome map
AA seq 651 aa AA seqDB search
MLQEVYYPKKEMFKDPAFKNMCEYHELVEEFEKDYEGTWAKFAREKITWFEDFKQTLDTS
NAPFYKWFVGGKLNVAYQCIDRHLENRKNKAAIIWEGDNGEKRIITYLELYREVNRFANL
LKSLGVKKGDRVVIYMPMIPEAAFAMLACARIGAIHSVVFGGFSAEALKDRILDAEAKVV
ITADGAFRKGSPYMLKPTVDIALEGVDIVEKVIVVERNNEDIEWVSGRDISYNDLIVNQS
DECPAEIMDSEDPLFLLYTSGSTGKPKGVQHAQAGYILWAQLTMEWVFDIKDNDTYWCTA
DIGWITGHTYIVYGPLAAGATTLMFEGVLTYPDSGRAWKMVEEYKVNQFYTAPTAIRLLN
KMGPDEPKKYDLSSLRILGTVGEPIDPPAWKWYYEVVGGGRCSIVDTWWQTETGGHMITP
LPAATPVKPASATFPLPGIFAEIIDETGERMPAHEKGLLCITKPWPSMIRTIWGDPERFV
KSYFSTAKKMGEPVYFSGDGAMYDEDGYIWITGRVDDVINVSGHRLGTAEIEAAIKKHPL
IAEVAVVGRPDEIKGESVFAYVVLKGEDTVAEEMEIIKEINEIVKEEIGAIAKVDTVAFV
PGLPKTRSGKIMRRILRAIAKGEAITQDTSTLEDPKVVEAIIEVVNSCILK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagaagtatattatcctaaaaaagaaatgtttaaagaccctgcatttaaaaat
atgtgtgaatatcatgaattagtggaagagtttgaaaaagactatgaaggaacatgggcg
aaatttgcaagagaaaaaatcacttggtttgaagatttcaaacaaactcttgatacttca
aacgcgcctttttataaatggtttgtaggcggaaaattaaatgttgcatatcagtgtatc
gacagacatttagaaaacagaaaaaacaaagctgcaataatatgggaaggtgacaacgga
gaaaaaagaataatcacttatcttgaactttacagggaagtcaacagatttgcaaacctt
cttaaaagtttgggagttaaaaaaggagacagggttgtaatttatatgccgatgattcct
gaagcggcttttgcaatgcttgcatgtgcaagaatcggtgcgattcatagtgtcgtattc
ggaggatttagtgcagaagcacttaaagacagaattcttgacgcagaagcaaaagtagtg
ataactgctgacggtgcgtttagaaaaggcagcccttatatgttaaaacctacagtagat
atagcgcttgaaggcgttgatatcgtagaaaaagtaatagttgttgaaagaaacaatgaa
gatattgagtgggtaagcggaagagatataagctataacgatttaatagtaaatcaaagc
gatgaatgtcctgctgaaattatggacagtgaagatccgctattcttgttatatacatct
ggtagtaccggaaaaccaaaaggtgtgcaacacgcacaagccggatatattctttgggca
cagcttacaatggaatgggtatttgatataaaagacaacgacacatactggtgtacggcc
gacatcggctggattaccggacatacatatatcgtatacggacctcttgcagccggtgcg
acgactcttatgtttgaaggtgtgctaacatatcctgacagcggaagagcatggaaaatg
gttgaagaatataaagttaaccaattctatacagcacctacggcaatcagacttcttaat
aaaatgggacctgatgagcctaaaaaatacgatttaagctcattaagaattttaggaaca
gttggtgagcctatcgatcctcctgcatggaaatggtattacgaagttgtaggtggtggt
agatgttcaatcgttgatacatggtggcagactgaaaccggaggacatatgataacacct
cttccggcagcgacacctgtaaaacctgcaagtgcaacattccctcttccgggaatattt
gcggaaattatcgatgaaacaggtgaaagaatgccagcacacgaaaaaggtcttttatgt
attacaaaaccgtggccgagtatgattagaactatctggggagatcctgaaagatttgta
aaaagttatttctcaactgccaaaaaaatgggagaaccggtatacttctcaggtgacggt
gctatgtatgacgaagacggatatatctggattacaggtagggttgatgatgttataaac
gtttcagggcacagactcggaactgcagaaatcgaagctgcaattaaaaaacatccgtta
attgccgaagttgctgttgtcggaagacctgatgaaattaaaggtgaaagcgtatttgct
tatgttgttttaaaaggtgaagacacagtagctgaagaaatggaaattattaaagaaatc
aacgaaatagtaaaagaggaaatcggtgcgattgcaaaagttgacacagtggcgtttgtt
ccgggacttcctaaaacaagaagcggtaaaattatgagaagaatccttagagcgatagca
aaaggtgaagcaattacacaagatacttcaacacttgaagatcctaaagttgttgaagca
atcattgaagtagtaaacagctgtattttaaaataa

DBGET integrated database retrieval system