KEGG   Nautilia profundicola: NAMH_1011Help
Entry
NAMH_1011         CDS       T00860                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nam  Nautilia profundicola
Pathway
nam00010  Glycolysis / Gluconeogenesis
nam00620  Pyruvate metabolism
nam00640  Propanoate metabolism
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAMH_1011 (acsA)
   00620 Pyruvate metabolism
    NAMH_1011 (acsA)
   00640 Propanoate metabolism
    NAMH_1011 (acsA)
  Energy metabolism
   00680 Methane metabolism
    NAMH_1011 (acsA)
Enzymes [BR:nam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NAMH_1011 (acsA)
Lipid biosynthesis proteins [BR:nam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NAMH_1011 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C
Motif
Other DBs
NCBI-ProteinID: ACM93114
UniProt: B9L9V3
Position
928460..930415
Genome map
AA seq 651 aa AA seqDB search
MLQEVYYPKKEMFKDPAFKNMCEYHELVEEFEKDYEGTWAKFAREKITWFEDFKQTLDTS
NAPFYKWFVGGKLNVAYQCIDRHLENRKNKAAIIWEGDNGEKRIITYLELYREVNRFANL
LKSLGVKKGDRVVIYMPMIPEAAFAMLACARIGAIHSVVFGGFSAEALKDRILDAEAKVV
ITADGAFRKGSPYMLKPTVDIALEGVDIVEKVIVVERNNEDIEWVSGRDISYNDLIVNQS
DECPAEIMDSEDPLFLLYTSGSTGKPKGVQHAQAGYILWAQLTMEWVFDIKDNDTYWCTA
DIGWITGHTYIVYGPLAAGATTLMFEGVLTYPDSGRAWKMVEEYKVNQFYTAPTAIRLLN
KMGPDEPKKYDLSSLRILGTVGEPIDPPAWKWYYEVVGGGRCSIVDTWWQTETGGHMITP
LPAATPVKPASATFPLPGIFAEIIDETGERMPAHEKGLLCITKPWPSMIRTIWGDPERFV
KSYFSTAKKMGEPVYFSGDGAMYDEDGYIWITGRVDDVINVSGHRLGTAEIEAAIKKHPL
IAEVAVVGRPDEIKGESVFAYVVLKGEDTVAEEMEIIKEINEIVKEEIGAIAKVDTVAFV
PGLPKTRSGKIMRRILRAIAKGEAITQDTSTLEDPKVVEAIIEVVNSCILK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagaagtatattatcctaaaaaagaaatgtttaaagaccctgcatttaaaaat
atgtgtgaatatcatgaattagtggaagagtttgaaaaagactatgaaggaacatgggcg
aaatttgcaagagaaaaaatcacttggtttgaagatttcaaacaaactcttgatacttca
aacgcgcctttttataaatggtttgtaggcggaaaattaaatgttgcatatcagtgtatc
gacagacatttagaaaacagaaaaaacaaagctgcaataatatgggaaggtgacaacgga
gaaaaaagaataatcacttatcttgaactttacagggaagtcaacagatttgcaaacctt
cttaaaagtttgggagttaaaaaaggagacagggttgtaatttatatgccgatgattcct
gaagcggcttttgcaatgcttgcatgtgcaagaatcggtgcgattcatagtgtcgtattc
ggaggatttagtgcagaagcacttaaagacagaattcttgacgcagaagcaaaagtagtg
ataactgctgacggtgcgtttagaaaaggcagcccttatatgttaaaacctacagtagat
atagcgcttgaaggcgttgatatcgtagaaaaagtaatagttgttgaaagaaacaatgaa
gatattgagtgggtaagcggaagagatataagctataacgatttaatagtaaatcaaagc
gatgaatgtcctgctgaaattatggacagtgaagatccgctattcttgttatatacatct
ggtagtaccggaaaaccaaaaggtgtgcaacacgcacaagccggatatattctttgggca
cagcttacaatggaatgggtatttgatataaaagacaacgacacatactggtgtacggcc
gacatcggctggattaccggacatacatatatcgtatacggacctcttgcagccggtgcg
acgactcttatgtttgaaggtgtgctaacatatcctgacagcggaagagcatggaaaatg
gttgaagaatataaagttaaccaattctatacagcacctacggcaatcagacttcttaat
aaaatgggacctgatgagcctaaaaaatacgatttaagctcattaagaattttaggaaca
gttggtgagcctatcgatcctcctgcatggaaatggtattacgaagttgtaggtggtggt
agatgttcaatcgttgatacatggtggcagactgaaaccggaggacatatgataacacct
cttccggcagcgacacctgtaaaacctgcaagtgcaacattccctcttccgggaatattt
gcggaaattatcgatgaaacaggtgaaagaatgccagcacacgaaaaaggtcttttatgt
attacaaaaccgtggccgagtatgattagaactatctggggagatcctgaaagatttgta
aaaagttatttctcaactgccaaaaaaatgggagaaccggtatacttctcaggtgacggt
gctatgtatgacgaagacggatatatctggattacaggtagggttgatgatgttataaac
gtttcagggcacagactcggaactgcagaaatcgaagctgcaattaaaaaacatccgtta
attgccgaagttgctgttgtcggaagacctgatgaaattaaaggtgaaagcgtatttgct
tatgttgttttaaaaggtgaagacacagtagctgaagaaatggaaattattaaagaaatc
aacgaaatagtaaaagaggaaatcggtgcgattgcaaaagttgacacagtggcgtttgtt
ccgggacttcctaaaacaagaagcggtaaaattatgagaagaatccttagagcgatagca
aaaggtgaagcaattacacaagatacttcaacacttgaagatcctaaagttgttgaagca
atcattgaagtagtaaacagctgtattttaaaataa

DBGET integrated database retrieval system