KEGG   Nautilia profundicola: NAMH_1219Help
Entry
NAMH_1219         CDS       T00860                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nam  Nautilia profundicola
Pathway
nam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01130  Biosynthesis of antibiotics
nam01230  Biosynthesis of amino acids
Module
nam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAMH_1219 (trpC)
Enzymes [BR:nam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NAMH_1219 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACM92217
UniProt: B9LAF4
Position
complement(1120874..1121650)
Genome map
AA seq 258 aa AA seqDB search
MILDKIIAQTKKDLDNRKNSNDFNKFLAQKRDFRDVKKALKATPDNPYRIIAEVKKASPS
KGIIKEDFNPVEIAKEYIEVADAMSILTEPHFFQGSLEYLKEINKFSPIPLLRKDFIIDE
FQIAEAYAAGADFILLIAKALDVSTLKRLYDFAKNTGLEVLFEIHDEEDLQKGLEVGADI
IGFNHRNLETFEMDMDLSKKLIPKLPKNVIVVAESGINDFETVKKLSRNGVDAYLVGEHF
MRQDNIKKAVLTLKGKTE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgataagatcatcgctcaaacaaaaaaagatttggataatagaaaaaatagt
aatgattttaataaatttttagctcaaaaaagagatttcagggatgtgaaaaaagcccta
aaagccacaccggataatccgtacagaataatagccgaagttaaaaaagcaagtccttca
aaaggaatcatcaaagaagacttcaatcctgttgaaatcgcaaaagaatatatagaagtt
gcggatgcaatgagtatattaacggagccgcatttttttcaggggagtctggaatattta
aaagagattaataaattcagtccgattccgcttttaagaaaagattttataattgacgaa
tttcaaatagccgaagcttatgcggcgggggccgattttattttgcttattgctaaagct
cttgatgtttctacacttaaaagactatatgattttgcgaaaaacacaggtcttgaagta
ctttttgaaattcacgacgaagaagatttacaaaaaggccttgaagtcggtgccgatatt
ataggatttaatcacagaaatcttgagacttttgaaatggatatggatttaagtaagaaa
ctgattccaaaacttccaaaaaatgtgattgtagtagctgaaagcggtatcaatgacttt
gaaactgttaaaaaactctcccgtaacggagtcgacgcgtatttggtgggcgagcatttt
atgaggcaggataatattaaaaaagccgttttaacattaaagggtaaaacggaatag

DBGET integrated database retrieval system