KEGG   Nautilia profundicola: NAMH_1329Help
Entry
NAMH_1329         CDS       T00860                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nam  Nautilia profundicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NAMH_1329 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_1329 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAMH_1329 (trpB)
Enzymes [BR:nam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NAMH_1329 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1227357..1228568
Genome map
AA seq 403 aa AA seqDB search
MKKSHLQKFPDSEGFFGRFGGAYIPDVLKDEFERITKAYMKLRRSHDFLSELRRIRKHYQ
GRPTPVYHAKRLSEALGGAQIYLKREDLNHMGAHKLNHCMAEALLAKYMGKKKLIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMKILGAEVIPATHGLKTLKEAVDS
AFESYVKQIDTALYAIGSVVGPHPFPMMVRDFQSVVGFEAKEQFMEMVGFLPDNVVACVG
GGSNAMGIFSGFIDDEVELYAVEPLGKGTKLGEHAATLMYGDEGVIHGFNTIMLKDENGE
PAPVHSIASGLDYPGVGPEQAYLKEIGRLNIAAITDEETIDAFFALSQYEGIIPALESAH
AVAYAMKLAKEKPNDTILVNLSGRGDKDIDYVVENYGVREIKL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcacacttgcaaaaattcccggacagtgaaggatttttcggaagattcgga
ggtgcgtatattcccgatgttttaaaagatgaattcgaaagaattacaaaagcgtatatg
aaactaagacgctcacacgattttttgagtgagcttagaagaatcagaaaacactaccag
gggcgccctaccccagtatatcatgccaaaagactctcagaagcactcggaggagctcag
atatacctcaaaagagaagatctgaaccacatgggtgcacacaaattaaaccactgtatg
gcggaagccctgcttgctaaatatatgggtaaaaagaaactaatagccgaaacgggagca
ggacagcacggtgtggcgcttgcaaccgcagcggcatatttcggacttgagtgtgaaata
cacatgggggaagtggatattgcaaaagaacacccgaatgttgtcagaatgaaaatattg
ggagcggaggtaattcctgccactcacggactgaaaacactcaaagaagctgtcgacagc
gcgtttgagagttatgtaaaacagatagatactgcactgtacgcaatcggaagcgtcgtg
ggacctcatccgtttcctatgatggtaagggatttccaaagtgtagtcggatttgaagca
aaagagcagtttatggaaatggttggattcctgcctgataacgttgtggcgtgtgtagga
ggcggaagcaacgccatggggattttcagcggctttatagacgatgaagttgagttatac
gcggttgagcctcttggaaaaggcaccaaactcggagagcacgccgctacacttatgtac
ggtgatgaaggtgtaatccacggatttaatactattatgttaaaagatgaaaacggagaa
ccagcaccggtacattcaatcgcaagtggacttgactacccgggagttggaccggaacaa
gcgtatcttaaagaaatcggaagattaaacatcgcagcaattacagacgaagaaacgatt
gacgcattctttgctttaagccaatatgagggtataattccggcgcttgaaagcgcacac
gcagtagcgtatgccatgaaactcgcaaaagaaaaaccaaacgatactattttggtaaac
ctctctggaagaggagacaaagatatcgactatgtagttgaaaactacggggttagagaa
attaaactgtaa

DBGET integrated database retrieval system