KEGG   Nautilia profundicola: NAMH_1586Help
Entry
NAMH_1586         CDS       T00860                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nam  Nautilia profundicola
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NAMH_1586 (galU)
   00052 Galactose metabolism
    NAMH_1586 (galU)
   00500 Starch and sucrose metabolism
    NAMH_1586 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NAMH_1586 (galU)
Enzymes [BR:nam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NAMH_1586 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1489180..1489992)
Genome map
AA seq 270 aa AA seqDB search
MIKKALFPAAGYGTRFLPATKSVPKEMLPVVNKPLIHYGIMECMNAGINEIGFVTGRNKR
AIEDYLDFSPELEEKIKDSSKAKLLHETNEMINKCTFTYVRQKEMLGLGHAVLTGEPLIG
DNPFAVVLADDLCEGDVLTQMVKLYNKFKCTIVAIEEVPKEEVNKYGVIAGREIEEGVYM
VDDMVEKPDVDKAPSNLAIIGRYILTPDIFDLLKITKPGRGGEIQLTDALLKQAKEGMVI
AYKFKGKRFDCGSVKGFIEATNYFYEKEFK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagctttatttccggctgcggggtacggtacgagatttttaccggctaca
aaatcggtaccaaaagagatgttacctgtggtaaacaaacctctaattcattacggaata
atggaatgtatgaatgccggtataaatgaaatagggtttgtaacaggaagaaacaaaaga
gctattgaagattatttggatttttcacccgagcttgaagagaaaataaaagactcgagt
aaagcgaaacttttacacgaaactaatgaaatgataaacaaatgcacatttacatacgta
agacaaaaagagatgttaggacttgggcacgcggtgcttacaggggaacctttaataggg
gataatccttttgcggtggtgcttgcggatgatttatgtgaaggcgatgtattaacccaa
atggtgaaactatataacaaattcaaatgtacaatcgtagcaatagaagaagtaccgaaa
gaagaggtgaataaatacggagtaatagccggaagagagatagaagaaggtgtgtatatg
gtggatgatatggttgaaaaaccggatgtggataaagcaccgagtaatttagcgataata
ggaagatatatacttacacctgatatttttgatctgttaaaaatcactaaaccaggacga
ggaggggaaatacagcttacagacgctcttttaaaacaggcaaaagaaggaatggtaata
gcgtataaattcaaaggtaaaagatttgactgcggaagtgtaaaagggtttattgaggca
actaattatttttatgagaaggaatttaaataa

DBGET integrated database retrieval system