KEGG   Nautilia profundicola: NAMH_1691Help
Entry
NAMH_1691         CDS       T00860                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nam  Nautilia profundicola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nam00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NAMH_1691
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NAMH_1691
Enzymes [BR:nam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NAMH_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1577702..1578934)
Genome map
AA seq 410 aa AA seqDB search
MNYKELIQKDLITDNTKELSEDKLFLKTKQNEKYSKDISKYITPKELIQNLTLKTKFIGI
TGTNGKTTTAFVLGHLLQQAGYSVGIQGTEGFYLNGEKIEAKTLTTPPIFTTIKRAVKYE
PDFYIMEVSSHAIVQQRIEGIEFTAKILTSFSQDHLDYHKTMEEYKRVKESFFRDETVKV
FNGKLLVKNEKCKVKSGGYEFNLNCKNLYVLEKPIVDDIPMAGEFNKMNFSLALKTASLL
TNSSLSTFNFSLFEGVPGRMEIVSKKPLVIIDFAHTPDGMEKVLSAVEGKKIVVFGAGGD
RDKDKRHLMGEVADKYAEYIIITEDNPRCEDSNEICKEIAKGIKSIPYKIISNRKDAIKE
AVDIAKKKNYTLMLLGKGDENYIQYCDKKIDYSDRETVKKLLSNKVVKVN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaactacaaagaacttatacaaaaagatcttattactgacaatacaaaagagcttagt
gaagataagctattcttaaaaaccaaacaaaatgaaaaatactctaaagatatctcaaaa
tatattactccaaaagaactgatacaaaacttaacccttaaaacaaaattcataggaatt
acaggtacaaacggtaagacgacaactgcgtttgtccttggacatttattgcaacaagcc
ggatacagtgtaggtattcagggtactgaaggtttttatctaaacggtgaaaaaattgaa
gccaaaaccctgacgactcctccaatattcacaacgattaaaagagctgtgaaatatgag
ccggatttttacattatggaagtaagctctcatgcaatagtgcagcaaaggatagaaggt
attgaatttacggctaaaatactgacttcattctcgcaggatcatcttgattatcataaa
acaatggaagaatacaaaagagttaaagaaagtttttttcgggatgaaaccgttaaagtt
ttcaatggaaaacttttagtgaaaaatgaaaagtgtaaagtgaaaagtggagggtatgaa
tttaatttaaactgtaagaatttatatgttttggaaaaaccaatagtagatgatatccca
atggcaggcgagtttaataagatgaatttttcattagccttgaaaacagcttcgttgctt
acaaactcttcactttcaacttttaacttttcactttttgagggtgttcccggaagaatg
gaaatagtttcgaaaaagcctcttgttataattgattttgcgcatactccggacggtatg
gaaaaagtactaagcgcggtggaagggaaaaagattgttgttttcggtgcaggaggagac
agggataaagataaacgccatctgatgggtgaagttgcagataaatatgcagaatatata
attattacggaagataacccgagatgtgaagattcaaatgaaatttgtaaagagatcgct
aaaggtataaaaagcataccgtataaaataatatcaaatcgaaaagatgctatcaaagaa
gctgtagatatagctaaaaagaaaaattatacactaatgcttttaggcaaaggtgatgaa
aactacatacagtactgtgataaaaaaattgattatagtgacagggagacggttaagaag
ttgttaagtaataaagttgttaaggttaattag

DBGET integrated database retrieval system