KEGG   Nautilia profundicola: NAMH_1761Help
Entry
NAMH_1761         CDS       T00860                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nam  Nautilia profundicola
Brite
Enzymes [BR:nam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NAMH_1761 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 RrnaAD Methyltransf_23 NodS Methyltr_RsmB-F Methyltransf_32 MTS Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ACM92428
UniProt: B9L6Z1
Position
complement(1639256..1639864)
Genome map
AA seq 202 aa AA seqDB search
MSKILADKIADYVELGPREYKAFCEIDRKYFVPAGFERKAYDITPLPLADDSTISSPLTI
AKMTSYLELDDVDSVLEIGCGSGYQAAILSKIVRRVFTIDRICRLVEVAKERFKKLGLYN
INVKCDDGRFGWRAYAPFDRILLSAYIEDMEKELLSQVKDDGFILAPVKVGNEQVITRFY
KDGRKEMLEACEFVPVKKGVVK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatacttgcggataaaatagcggattatgttgaacttggacctagggaatat
aaggcgttttgtgaaatagacagaaaatacttcgtcccggccgggtttgaaagaaaagca
tacgatattactcctctccctctcgccgatgattcaacaatcagctcaccccttacaatt
gccaaaatgacttcttaccttgaactcgatgatgtggacagtgtacttgaaataggatgc
ggtagtggttatcaggcggcgattctcagtaaaatagtaagaagggtgtttacgattgac
agaatctgcagacttgttgaagttgcaaaagagagatttaaaaaattaggcctgtataat
attaatgttaagtgtgatgacggaagattcggttggagggcttatgctccgtttgacagg
atacttctttcggcgtatatagaagatatggaaaaagaactgctctcacaggttaaagat
gacggatttattctcgcacctgtaaaagtaggaaatgagcaggttattacaaggttttac
aaagacggcagaaaagaaatgcttgaagcgtgtgaattcgtaccggtaaaaaaaggtgtt
gtaaaatag

DBGET integrated database retrieval system