KEGG   Novosphingobium aromaticivorans: Saro_0084Help
Entry
Saro_0084         CDS       T00322                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Saro_0084
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Saro_0084
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(86610..88079)
Genome map
AA seq 489 aa AA seqDB search
MSGDLVLVIDAGTTSTRALLFGRDGRCHGVMQSEFAQHYPRPGQVEHDADEIWRATLGCM
REVVGVVGIERIAAIGVTNQRETVVAWDRTTGQPLARAIVWQDRRTAPMCDRLRSEGAEP
LVQSRTGLLLDPYFSGTKMRWMLDNEPAVAGAARDGRLALGTVESWLVWKLTGGARHVTD
ASNASRTLLLALDGADWDEELLDLFGVPRAVLPEVTDSLGEFGAALPEWLDASVPVRGLA
GDQQAATIGQGCLAPGEVKATYGTGAFVLAAMGDAVPRSGHRLLGTVLVQDKGVRSFALE
GSVFVAGSLIKWLRDAMGLVGSAAETAALAASVPDSGGVVLVPALSGLGAPHWRPDASAA
LTGMTFSTTRAHVVRAALEAMAHQTLDLMDAFAADRAPWTSLRIDGGMSANDWVAQDLAD
ILDLPVERPVMVETTALGAGMLAAVASGWFGSLGEAEAMRGSVTRFEPRMAPGVRAARIA
RWREALAKV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgatctggtactggtgatcgatgcgggcacgacctcgacgcgggctctcctg
ttcgggcgggacgggcgctgccatggcgttatgcaaagcgaatttgcgcagcattatccc
cgcccgggccaggtcgaacacgatgcggacgagatctggcgcgcgacgcttggctgcatg
cgcgaggtggtcggggtcgtcggtatcgagcgcatcgcggcgattggggtaaccaaccag
cgcgagaccgtcgtcgcctgggatcgcacgaccgggcaacccctggcgcgggccatcgtc
tggcaggatcgccgcaccgcgcccatgtgcgaccggttgcgatcggaaggggcggagccg
ctggtccagtcccgaaccgggctgctgcttgatccctatttctcgggcaccaagatgcgc
tggatgctcgacaacgagccagcggtcgccggagccgcgcgcgacgggcggctggctctg
ggcacggttgaatcatggctggtgtggaagctcacgggtggagcgcgccacgtaaccgat
gccagcaacgccagtcgcacgctgcttctcgctctcgatggcgcggactgggatgaggag
ttgctcgacctgttcggcgtgccgcgcgcggtgctgcccgaggttaccgacagtctggga
gaatttggcgcggcgctgcctgaatggctggacgcgtccgtgccggtcagaggtctggcc
ggggaccagcaggccgcaaccatcgggcagggctgtcttgcgcccggcgaagtcaaggca
acctacgggaccggtgccttcgtgttggcggcaatgggtgacgcggtgccgcgttcgggc
catcgcctgctcggcacggtgctggttcaggacaagggcgttcgcagttttgcgctggaa
ggttcggtctttgtcgcagggagcctgatcaagtggctgcgcgatgcgatgggcctggtc
ggctccgccgcagaaacggccgcgcttgcggcttcggtgccggacagtggcggggtcgtg
ctggtgccggcgctctccggcctcggagcgccgcactggcggcccgatgcgtccgcggcg
cttacaggaatgacgttttcgaccacgcgcgcccatgtcgtgcgcgccgcgctggaggcg
atggcgcaccagacgctcgacctcatggacgccttcgccgccgaccgcgcaccctggacc
tcgcttcgcatcgatggcggcatgagtgcgaacgattgggtggcgcaggatcttgccgat
atcctcgacctgcctgtggagcggccggtcatggtcgagactacggccctgggcgcgggg
atgctggcggcggtcgcgtccggctggttcggatcgctgggcgaagcggaggccatgcgc
gggtccgtcacgcggttcgaaccgcgcatggcgccaggtgtccgggccgcgcggatcgcg
cggtggcgcgaggcgctcgcgaaagtctga

DBGET integrated database retrieval system