KEGG   Novosphingobium aromaticivorans: Saro_0187Help
Entry
Saro_0187         CDS       T00322                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Saro_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(191067..191660)
Genome map
AA seq 197 aa AA seqDB search
MTVVEDRPAADEMLVARRAMIDSQLRVSGVNTPAILAAFAAVPREDFVPADRRTVAYADR
AQPLGDGRSLSPALTYGQMLEAAAATKDDSVLVISPNGYLAALAGHLAGTVARADSLTDA
KGGPYSLILIDGAAEVLPESLAALLSDEGRIVTGLFDRGVTRLGVARKALGKVVATPLAE
ADFAVLPEMAAPRKWSF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggttgaagaccgtccggctgcagacgagatgctggtcgcgcgccgcgcgatg
atcgatagccagcttcgcgtcagcggcgtgaacacgcccgcgatccttgccgctttcgcc
gccgtcccgcgcgaggacttcgttcccgcggaccgccgcaccgtcgcctatgccgaccgc
gcgcaaccgcttggcgatggtcggtcgctctcgcccgccctgacctacggccagatgctc
gaagccgcggccgcgacgaaggacgacagcgtcctcgtgatttcgcccaacggctacctc
gccgccctcgccggccatctggcgggcacggtcgcccgtgccgacagcctgaccgatgcc
aagggtgggccctactcgctgatcctgatcgacggcgcggcggaagtgctgcccgagtcg
ctggccgcgctgctatcggacgagggccgcatcgtaaccggcctgttcgaccgtggcgtc
acccgcctcggcgttgcccgcaaggcgcttggcaaggttgtcgccacccccttggccgaa
gccgatttcgccgtgctgcctgaaatggccgcgcccaggaaatggagcttctga

DBGET integrated database retrieval system