KEGG   Novosphingobium aromaticivorans: Saro_0422Help
Entry
Saro_0422         CDS       T00322                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Saro_0422 (ruvA)
Enzymes [BR:nar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Saro_0422 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459269..459883
Genome map
AA seq 204 aa AA seqDB search
MIAKLTGILDDTGPDWAVIDVNGVGYLVHCSAKTLTHLGLRGDKVVVHTEMQVSETDQRL
IGFTSAGERAWFRLLTAVQGVGSKVALAILSALSVEELQRACAHGDSAMVARANGVGPKL
ASRIVNELKDKAGGLAGYASPVGPGGEAFVAPPGNASADAVSALQNLGFKPAVASSAVAA
AVKELGEDAGLNDLVRVALKRAAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagctcaccggcattcttgacgacaccgggcccgattgggccgtgatcgac
gtgaacggcgtcggctacctcgtccattgctcggccaagacgctcacccatctcggcctc
cggggtgacaaggtcgtcgtccacaccgaaatgcaggtgagcgagaccgaccagcgcctg
atcggctttaccagcgcgggcgaacgcgcgtggttccggctgctgacggcggtgcagggc
gtcggcagcaaggtcgctcttgcaatcctttcggcactgtcggtcgaggaactccagcgc
gcctgtgcccacggcgacagcgcgatggtggcgcgcgccaatggcgtcggccccaagctc
gccagccgcatcgtcaacgaactgaaggacaaggccggcggtcttgcgggctatgcctcg
ccggtcggcccgggcggcgaggccttcgtcgcgccccctggaaatgccagcgcggatgcg
gtctcggccttgcagaacctcggtttcaaacccgccgtcgccagcagcgccgtcgccgca
gcagtcaaggaactgggcgaggatgcggggttgaacgacctggtgcgcgtggcgctgaag
cgggcggcgggataa

DBGET integrated database retrieval system