KEGG   Novosphingobium aromaticivorans: Saro_0450Help
Entry
Saro_0450         CDS       T00322                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00040  Pentose and glucuronate interconversions
nar00052  Galactose metabolism
nar00500  Starch and sucrose metabolism
nar00520  Amino sugar and nucleotide sugar metabolism
nar01100  Metabolic pathways
nar01130  Biosynthesis of antibiotics
Module
nar_M00362  Nucleotide sugar biosynthesis, prokaryotes
nar_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Saro_0450
   00052 Galactose metabolism
    Saro_0450
   00500 Starch and sucrose metabolism
    Saro_0450
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_0450
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Saro_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABD24898
UniProt: Q2GB75
Position
492864..493802
Genome map
AA seq 312 aa AA seqDB search
MHQEYETTFGYRGGMTLKEQRKPIRKAVFPVAGLGTRFLPATKAIPKEMLPIIDRPLIQY
AVDEAREAGIEQLIFVTGRGKTAIVEHFDTAYELEHTMRDRGKVLDILAPTRIQPGNLVT
VRQQVPMGLGHAIWCARAVVGDEPFAIFLPDEMMIGTPGCMKQMVDAYEDVGGNLISVLE
VPAAEVSSYGVIAPGARVSDTLTEVKGLVEKPKREDAPSNLIISGRYILQPEVMRTLECQ
ESGAGGEVQLTDAMARMIGRQPFHAVTFAGRRYDCGSKAGFVEATLALALEREDMAEDVR
AIMRRLLAQSGG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgcatcaagaatatgaaacaaccttcggatatcgcggcgggatgacattgaaagaacag
cgaaagcccatccgcaaggcggtctttccggtcgcggggctgggaacccgcttcctgcct
gcgacaaaggcgatcccgaaggaaatgctgccgatcatcgaccgcccgctgatccagtac
gcggtcgacgaggcgcgcgaggccggcatcgagcagctcatcttcgtgaccggtcgcggc
aagaccgcgatcgtcgagcatttcgacacggcctacgaactcgaacacacgatgcgcgat
cgcggcaaggtactcgatattctcgcgccgacgcggatccagccaggcaatctcgtgacc
gtgcggcagcaggtgccgatgggtcttggccacgccatctggtgcgcgcgcgcggtcgtg
ggggatgaacctttcgcgatcttccttccggacgaaatgatgatcggcacgcccggctgc
atgaagcagatggtcgatgcctacgaagacgtcggcggcaatctcatttccgtgctcgaa
gtgcccgcggcagaagtgtcgagctacggcgtcatcgctcccggcgcccgggtttccgac
acgctgaccgaagtgaagggcctggtcgagaagccgaagcgcgaggacgcaccttcaaac
ctcatcatttccggccgctacatcctccagccggaagtcatgcgcactctcgaatgccag
gaaagcggcgcgggcggcgaagtgcagttgaccgatgcgatggcgcggatgatcggccgc
cagccgttccacgccgtgaccttcgccgggcgacgctacgactgcggcagcaaggccggc
ttcgtcgaggcgacgctcgccctggcgctcgagcgcgaggatatggccgaagacgtgcgc
gcgatcatgcgtcgcctgctggcacaaagcggcggctag

DBGET integrated database retrieval system