KEGG   Novosphingobium aromaticivorans: Saro_0450Help
Entry
Saro_0450         CDS       T00322                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nar00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nar00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nar00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nar00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492864..493802
Genome map
AA seq 312 aa AA seqDB search
MHQEYETTFGYRGGMTLKEQRKPIRKAVFPVAGLGTRFLPATKAIPKEMLPIIDRPLIQY
AVDEAREAGIEQLIFVTGRGKTAIVEHFDTAYELEHTMRDRGKVLDILAPTRIQPGNLVT
VRQQVPMGLGHAIWCARAVVGDEPFAIFLPDEMMIGTPGCMKQMVDAYEDVGGNLISVLE
VPAAEVSSYGVIAPGARVSDTLTEVKGLVEKPKREDAPSNLIISGRYILQPEVMRTLECQ
ESGAGGEVQLTDAMARMIGRQPFHAVTFAGRRYDCGSKAGFVEATLALALEREDMAEDVR
AIMRRLLAQSGG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgcatcaagaatatgaaacaaccttcggatatcgcggcgggatgacattgaaagaacag
cgaaagcccatccgcaaggcggtctttccggtcgcggggctgggaacccgcttcctgcct
gcgacaaaggcgatcccgaaggaaatgctgccgatcatcgaccgcccgctgatccagtac
gcggtcgacgaggcgcgcgaggccggcatcgagcagctcatcttcgtgaccggtcgcggc
aagaccgcgatcgtcgagcatttcgacacggcctacgaactcgaacacacgatgcgcgat
cgcggcaaggtactcgatattctcgcgccgacgcggatccagccaggcaatctcgtgacc
gtgcggcagcaggtgccgatgggtcttggccacgccatctggtgcgcgcgcgcggtcgtg
ggggatgaacctttcgcgatcttccttccggacgaaatgatgatcggcacgcccggctgc
atgaagcagatggtcgatgcctacgaagacgtcggcggcaatctcatttccgtgctcgaa
gtgcccgcggcagaagtgtcgagctacggcgtcatcgctcccggcgcccgggtttccgac
acgctgaccgaagtgaagggcctggtcgagaagccgaagcgcgaggacgcaccttcaaac
ctcatcatttccggccgctacatcctccagccggaagtcatgcgcactctcgaatgccag
gaaagcggcgcgggcggcgaagtgcagttgaccgatgcgatggcgcggatgatcggccgc
cagccgttccacgccgtgaccttcgccgggcgacgctacgactgcggcagcaaggccggc
ttcgtcgaggcgacgctcgccctggcgctcgagcgcgaggatatggccgaagacgtgcgc
gcgatcatgcgtcgcctgctggcacaaagcggcggctag

DBGET integrated database retrieval system