KEGG   Novosphingobium aromaticivorans: Saro_0757Help
Entry
Saro_0757         CDS       T00322                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nar00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nar00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805250..806563
Genome map
AA seq 437 aa AA seqDB search
MSADYFADFQTVRYEGPDSDNDFAYRWYDKDRVILGKRMEDHLRFAVCMWHTFCWPGSDV
FGAGTFTRPWLQGPMDARNAAAKREAALAFVEKLDVPFYCFHDVDVMAEAEGIGEFRSSF
AEAVDHLEELQGKHGRKLLWGTANLFGHPRYMAGAATNPDPEVFAWGASQVRDALEATHR
LGGANYVLWGGREGYDSILNTEIGIEQENFGRFLSLVVDHKHRIGFKGTILIEPKPHEPT
KHQYDFDTQTVFGFLKRFGLESEVKVNIEANHATLSGHTFEHELAMARALGILGSIDANR
GDHQNGWDTDQFPNSVEELTLAMLELIRAGGFTDGGFNFDAKVRRQSIDAADLFHGHIGG
IDTIAHALVKAAALIEDGKLDAFRAERYAGWQGELGRKIHADGTTLADIADIAVARDLAP
VRRSGRQEWCENLINRV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgattacttcgccgatttccagacggtccgctacgaagggccggacagcgac
aatgactttgcctatcgctggtacgacaaggaccgcgtgatcctgggcaagcgtatggag
gatcacctgcgctttgccgtctgcatgtggcacaccttctgctggcccggcagcgacgtg
ttcggtgcaggcacttttacccgcccctggctgcaaggcccgatggacgcgaggaacgca
gccgccaagcgcgaggctgcgctcgccttcgtcgagaagctcgatgttcccttctactgc
ttccatgacgtcgacgtgatggccgaggccgaaggcattggcgaattccgatcgagcttt
gccgaagcggtcgatcatctcgaggagctgcagggcaagcacggccgcaagctgctgtgg
ggtaccgccaatctgttcggtcaccctcgctacatggcaggcgccgcgaccaatcccgat
ccggaagtcttcgcctggggcgcaagccaggtgcgcgacgcgctggaagcgacccatcgc
ctgggcggcgcgaactacgtgctgtggggcggccgcgaaggctatgacagcatcctcaac
accgagatcgggatcgagcaggagaacttcgggcgcttcctgtcgctggtcgtggatcac
aagcatcgcatcggcttcaagggcacgatcctcatcgagcccaagccgcacgagccgacc
aagcaccagtacgatttcgacacccagaccgtattcggctttctcaagcgcttcgggctg
gaaagcgaagtgaaggtgaacatcgaggcgaatcatgcaacgctctcgggccatactttc
gaacacgaactggccatggcgcgcgctctcggcattctcggctcgatcgacgccaaccgt
ggcgaccaccagaacggctgggataccgaccaattccccaattcggtggaagaactgacg
cttgccatgcttgaactgatccgtgcgggcggcttcaccgatggcggcttcaatttcgac
gccaaggtgcgccgccagtcgatcgacgcggccgacctgttccacggccacatcggcggc
atcgacaccatcgcgcacgcgctggtcaaggcggcggcgctgatcgaggacggcaagctt
gatgccttccgcgccgaacgctacgcggggtggcagggggaactcggtcgcaagatccac
gcagacggcaccacgctggccgacatcgccgacatcgcggtagcgcgcgacctcgcgccg
gtgcgcaggtcgggcaggcaggagtggtgtgaaaacctgatcaaccgcgtttga

DBGET integrated database retrieval system