KEGG   Novosphingobium aromaticivorans: Saro_0817Help
Entry
Saro_0817         CDS       T00322                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nar  Novosphingobium aromaticivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Saro_0817
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Saro_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871129..871578
Genome map
AA seq 149 aa AA seqDB search
MRDVVRQRAGRHIQRGQDKFMGKFTGAFVVAGLAASALAGVAVAAPAKGDPVLGKKVFMR
CVACHAVQPNAPMKMGPNLAGVVGRKAGAANFKYSAAMKKANVKWDEATLDKWLLKPSAV
VPGTSMAFAGVPNAEERAAVIAYLKKPVP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgtggtccggcaacgggcagggcgtcatattcaaagagggcaggacaagttc
atgggcaagttcacgggtgcatttgttgtagcaggccttgcggcttcggctcttgcgggc
gtggccgtcgcggccccggccaagggtgatccggtgcttggcaagaaagtgttcatgcgc
tgcgtcgcctgccacgcggtccagccgaacgcgccgatgaagatgggcccgaaccttgcc
ggcgtggtggggcgcaaggccggcgccgcgaacttcaagtattccgccgccatgaagaag
gccaacgtgaagtgggacgaagccacgctcgacaagtggctgctgaagccgtcggcggtc
gtgcccggcacctcgatggccttcgccggcgtgcccaatgccgaggaacgcgcggcggtg
atcgcctatctgaagaagccggttccctga

DBGET integrated database retrieval system