KEGG   Novosphingobium aromaticivorans: Saro_0885Help
Entry
Saro_0885         CDS       T00322                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saro_0885
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_0885
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_0885
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Saro_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939719..941863
Genome map
AA seq 714 aa AA seqDB search
MDMGEMNGRIERSGLQVDAKLATFIDGEVLGPLGIQADAFWQGFAALVGHFTPVNRQLLV
KRDSLQALIDSWHRERRGKPIHAHEYRAFLSEIGYLVPEPDDFLIGTENVDREIASMAGP
QLVVPVLNDRFVLNAANARWGSLYDAWYGTDALDAPPARPGGYDKERGAAVVAAGRAFLD
LTFPLDSASWSDWDGEGVPPLCDADQFAGTKPGGILLCNNGLHVEIVLDRAHPVGADDKA
GIADIVMEAALTTIVDLEDSVAAVDAEDKLLAYRNWLGLMRGDLEASFQKGGRTLTRALE
ADREWTSAKGEPLTLPGRSLLFVRNVGHLMTNPAILLPDGSEIPEGIMDAVVTSAIAMHD
IRGLGRHRNSRAGSIYIVKPKMHGPEEVGFTNDLFNAVEDLLGLDRHTVKVGVMDEERRT
SANLAACIRAVKDRIVFINTGFLDRTGDEIHTSMQAGPMIRKGAIKGSGWIAAYEKRNVC
IGLAHGLSGKAQIGKGMWAAPDMMHDMMQQKIAHPKTGANTAWVPSPTAATLHAMHYHQV
AVFDVQREVAQEKTPGLDALLAIPLAEGTNWSAEEVREELDNNAQGLLGYVVRWIDQGVG
CSKVPDINDVGLMEDRATLRISSQHMANWLLHGVATGEQVMDSLKRMAAKVDAQNAGDPL
YEPMAGRWEESFAFRAACDLVFNGVEQPNGYTEPLLHAWRLKKKAAVGKVAEPA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggacatgggtgaaatgaacggacgtatcgagcgcagcgggcttcaggtcgacgcgaag
ctggccactttcatcgacggcgaggttctcggcccgctcggcattcaggccgacgcattc
tggcagggcttcgcggcgcttgtcggccactttaccccggtaaaccgccagcttctggtg
aagcgcgattccctccaggcgctgatcgattcctggcaccgcgagcgtcggggcaagccc
atccacgcgcacgagtaccgcgccttcctgagcgagatcggctatctcgtgcccgagccg
gacgacttcctgatcggaaccgaaaacgtcgaccgagagatcgcgtcgatggcggggccg
cagctcgtcgtgccggtcctcaacgaccggtttgtccttaatgccgcgaacgcgcgctgg
ggcagcctgtatgacgcatggtatggcaccgacgcgctcgatgcgccgccggcccgtccg
ggtggttacgacaaggaacgcggggccgcggtcgtcgccgccggacgcgcattcctcgac
ctgacgttccctctcgacagcgcgagctggtccgactgggatggcgaaggcgtgccgccg
ctgtgcgacgcggaccagttcgccgggacgaagcccgggggcatcctgctttgcaacaat
ggcctgcacgtcgagatcgtgctcgaccgcgcgcacccggtcggcgcagacgacaaggcg
ggcattgccgacatcgtgatggaagcggcgctgacgaccatcgtcgatctcgaggattcg
gttgcggcggtcgacgccgaggacaagctgctggcctatcgcaactggctgggcctgatg
cgcggcgacctggaggcgagcttccagaagggcggcaggacgctgacccgcgcgctggag
gctgaccgcgagtggacttcggccaagggcgagccgctgaccctgccggggcgcagcctg
ctgttcgtgcgcaacgtcggacacctgatgaccaaccctgcgatcctgcttcccgatggc
agcgagattcccgaagggatcatggatgcggttgtgacttcggccatcgcgatgcacgac
atcagggggctgggccgccatcgcaacagccgcgcgggcagcatctatatcgtgaagccc
aagatgcacgggccggaagaggtcggcttcaccaacgatctgttcaacgcggtcgaggac
ctgctcgggctggatcgccacacggtcaaggtcggggtgatggacgaggagcgccgcact
tcggccaacctcgccgcgtgcatccgcgcggtgaaggaccgtatcgtcttcatcaacacc
ggcttcctcgaccgtaccggcgacgagatccacacctcgatgcaggcggggccgatgatc
cgcaagggtgcgatcaaggggtcgggctggatcgccgcctacgagaagcgcaacgtctgc
atcggccttgcgcacgggctttccggcaaggcgcagatcggcaagggcatgtgggccgcg
cccgacatgatgcacgacatgatgcagcagaagatcgcgcacccgaagaccggcgcgaac
accgcctgggtgccttcgcccacggcagccacgctgcatgccatgcactaccaccaggtc
gcggtgttcgacgtgcagcgcgaagtggcgcaggagaagacgccggggctcgacgcgctg
ctcgcgattccgctggcggaggggaccaactggtcggccgaggaagtgcgcgaggagctg
gacaacaacgcgcaaggcctgctcggctatgtcgtgcgctggatcgaccagggcgtcggc
tgttcgaaggtgcccgacatcaacgacgtcggcctgatggaagaccgcgcgacgctgcgc
atttccagccagcacatggccaactggttgctgcacggcgtggccaccggtgagcaggtg
atggacagcctcaaacgcatggcggccaaggtcgatgcgcagaacgccggcgatccgctc
tatgagccgatggccggacgctgggaggaaagctttgccttccgcgccgcctgcgatctc
gtgttcaacggggtggaacagcccaacggctataccgagccgctgctgcacgcgtggcgc
ctgaagaagaaggcggcggtggggaaggtggccgaaccggcctga

DBGET integrated database retrieval system