KEGG   Novosphingobium aromaticivorans: Saro_0892Help
Entry
Saro_0892         CDS       T00322                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nar00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nar00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:nar03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nar03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nar03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949333..949764
Genome map
AA seq 143 aa AA seqDB search
MRVDFYQLTSDPAEQVLPLIARNTLAAGERLLVVSDDEAQLRRVGEALWTRLPETFLANG
RAGTAHDERQPILLSDAPEPANGAKFMALADGVWREGAFERVFLLFPPARIDDARGCWRM
LGTREGVERRYWRQDGGKWKEGP
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgatttctaccagcttaccagcgacccggccgaacaggtgctgccgctgatc
gcgcgcaacactctggcggcgggcgagcgcctgctggtcgtgtccgacgacgaggcccag
cttcgccgcgtcggcgaagcgctgtggacgcgcctgcccgaaaccttcctcgccaacggc
cgtgccggcaccgcccacgacgaacgccagccgatcctcctgtccgacgcccccgagccc
gccaatggcgcgaagttcatggcgctggccgatggcgtctggcgcgagggtgcgttcgag
cgcgtgttcctgctcttcccccccgcccgcatcgacgatgcccgtggctgctggcgcatg
ctcggcacgcgcgagggcgtggagcgccgctactggcgacaggacggcggcaagtggaaa
gaggggccctga

DBGET integrated database retrieval system