KEGG   Novosphingobium aromaticivorans: Saro_0921Help
Entry
Saro_0921         CDS       T00322                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saro_0921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_0921
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saro_0921
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saro_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973079..974500
Genome map
AA seq 473 aa AA seqDB search
MKYVSTRGQAPSLDFQGVTLAGLASDGGLYVPESWPQFSHDEIAAMAGLPYARLAQKIMQ
PYVGDCLTPERLLELCEQAYGRFAHAAVTPLKQLDETQWVLELFHGPTLAFKDVALQLLG
LLFEEFLARPREDGGDEHITIVGATSGDTGSAAIDAVAGRAKVDIFMLHPHGRVSDVQRR
QMTTVIAPNVHNIAIDGSFDDAQAMVKRMFNDSAMTGRFGIAAVNSINWARLMAQVVYYF
YAALQLGAPHRKVAFSVPTGNFGDVFAGYVAAKMGLPIERLIVATNVNDILHRALSAGDY
SASTVTPTAAPSMDIQVSSNFERLLFDGCGRDASALAAQMKHFEVTKAMQLTNAQRESAA
ALFSSARADAGDMANAMRWAFEATGEVLDPHTAIGLHAARAAEGIPAGVPIVTLATAHPA
KFVDAVERATGVRPGLPARVGDLFEREERCDRLPGNYEAVAAYVAERATPKHG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtcagcacccgggggcaggcaccctcgctcgatttccagggcgtcacgctc
gcaggcctcgcttcggatggcgggctctacgtgcccgagagctggccgcagttctcgcac
gacgagatcgccgcgatggccgggctgccctatgccaggctggcgcagaagatcatgcag
ccctacgtcggcgattgcctgacgccggagcgcctgctggagctgtgcgaacaagcctat
ggccgtttcgcgcacgctgccgtgacgccgctcaagcagctcgacgagacgcagtgggtg
ctcgaactgttccatgggccgacgctggctttcaaggacgtcgcgctccagttgcttggc
ctgctgttcgaggaattccttgcgcgtccgagagaggatgggggcgacgagcacatcacc
atcgtcggggcgacttcgggtgacaccgggtctgccgccatcgatgcggtggcgggtcgc
gccaaggtcgatatcttcatgctccacccgcatggccgggtatccgatgtgcagcgccgc
cagatgaccacggtcatcgcgcccaacgtccacaacatcgccatcgacggcagcttcgac
gatgcccaggcgatggtgaagcgcatgttcaacgacagcgcgatgaccggccgcttcggc
atcgccgccgtcaactcgatcaactgggcgcgcctgatggcgcaggtggtctactacttc
tacgccgcgctccagcttggcgcgccgcaccgcaaggttgccttctcggtgccgaccggc
aacttcggggatgtcttcgcaggctacgtcgcggcgaagatgggccttccgatcgagcgg
ctgatcgtggccaccaacgtcaacgacatcctccaccgcgcgctttcggcaggcgattat
tcggccagcaccgtaacgccgaccgccgcgccatcgatggacatccaggtttcctcgaac
ttcgagcgcctgctgttcgacggctgcggtcgcgacgcatcggcgcttgccgcgcagatg
aagcatttcgaagtgaccaaggcgatgcagctcacgaatgcgcagcgcgaatcggcggcc
gcgctgttcagctccgctcgcgccgatgcgggcgacatggccaatgccatgcgctgggcg
ttcgaggcgacgggcgaagtgctcgacccgcacaccgcgattggccttcacgcggcacgc
gcggccgaaggcatccctgcgggcgttccgatcgtgacgctggcgacggcccatccggca
aagttcgtcgacgcggtcgagcgcgccaccggcgttcgcccgggcctgcccgcccgcgtg
ggcgacctgttcgagcgcgaagagcgctgcgaccgcctgcccggcaactacgaagcggtt
gccgcctacgtcgccgagcgcgcgactccgaagcatggctga

DBGET integrated database retrieval system