KEGG   Novosphingobium aromaticivorans: Saro_1082Help
Entry
Saro_1082         CDS       T00322                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Saro_1082
Enzymes [BR:nar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Saro_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126076..1127068
Genome map
AA seq 330 aa AA seqDB search
MDFDTGRRIDRRAIPADAVEGTWTASDGHPIRRIDWPGHSEPDAPTAPRGSLLFLPGRGD
FYEKYLESLDYWHCEGWRVTALDWRGQAGSGRLSSDPMTGHVPDFGLWLDDLGAFWTDWV
RDTPGPHVVVGHSMGGHLVLRALAERRIDPAAVVLSAPMLGFLTPGPNRVLHRVAEFMCR
IGDPERSAWKSSEKPGATTAARNTLLTHDEARYGDETHWKTVRPELAMGPGSWRWVERAY
ASMLVLDRPGLLEAVDVPVLLLAARHDGLVSWRAIERAARRLPRAQLMTWGREARHELLR
EADPVRDKVMHAIDDFLDRLAPPTGEDAPA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgacacgggcaggcggatcgaccggagagcgattccagccgacgctgtcgag
gggacatggacggcaagcgacggtcatccgatacgccgcatagactggcccggccattcc
gaaccggacgctcccacggcgccgcgaggttcgctcctgttcctgccaggacgaggggat
ttctacgaaaagtatctggaatccctggattactggcattgcgaagggtggcgggtcacc
gcgctcgactggcgagggcaagctggctccggtcggctttcgtcggatccgatgacaggg
catgttcccgatttcgggctgtggctggacgaccttggcgcgttctggacggattgggtt
cgtgacacgcccggtccccatgtggtcgtgggccattcgatgggcgggcatctcgtgctt
cgcgccctcgccgagcgccggatcgatccggccgcggtggtgctgagcgcgcccatgctc
ggattcctgacaccaggcccgaatcgggttcttcaccgggtggccgagttcatgtgccga
atcggcgaccccgaacgaagcgcctggaagagcagcgaaaagcccggggcaaccacggcc
gcgcgcaatacgctcctcacgcatgacgaggcccgttacggtgacgagacgcactggaag
acggtgcggcccgaacttgcaatggggccgggaagctggcgctgggtggagcgggcctac
gcctcgatgctggtgctggacagaccggggctgctggaggcggtcgacgtgccggtgctt
ttgcttgccgcgcgccatgacgggctcgtttcctggcgcgcgatcgagcgtgcggcgcgg
cgcctgccgcgcgcgcaactgatgacctggggccgcgaggcaaggcacgagttgctccgt
gaggccgatccggtaagggacaaggtcatgcacgccatcgacgattttcttgaccgcctt
gccccgccgaccggggaggacgcacccgcgtga

DBGET integrated database retrieval system