KEGG   Novosphingobium aromaticivorans: Saro_1091Help
Entry
Saro_1091         CDS       T00322                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nar  Novosphingobium aromaticivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_1091
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Saro_1091
Enzymes [BR:nar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Saro_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134430..1135497
Genome map
AA seq 355 aa AA seqDB search
MGAPGLANGHGIRESTTMLPAIFGLSGLTLTEDERAFFRDADPAGYILFGRNVESPAQLR
ALTDELRALHGRDRTFICIDQEGGRVARMKPPVWQPYPPGERFDRLYDIAPASAIEAARA
NAEALGLDLAEAGISVDCLPLLDVRQPGAHDVIGDRALGSEPMRVAALGRATLDGLARAG
IAGVVKHMPGHGRALVDSHKELPTVSASAEELEMDLAPFRALRDATIGMTAHLRFLAWDD
WNPATHSPFVIEEIIRKAIGFDGLLLTDDLDMQALGGTVPERAARAQAAGCDIALNCWAK
MDDMVGIANSLAPMSDKVMQRLERALAPTAAFDAPADMTAQAALFDKRDRLLELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgctccgggccttgcaaatggccatggcatccgcgaatccaccaccatgcttccg
gcgatcttcgggctttcgggcctgaccctgactgaagacgaacgcgccttcttccgcgat
gcggacccggcgggatatatcctgttcggtcggaatgtggaaagcccggcgcagcttcgc
gccctgacggacgagctgcgcgcgctgcatggccgtgaccgcactttcatctgcatcgat
caggaaggcgggcgcgtcgcgcggatgaagccgccggtctggcaaccctatcctcccggc
gagcggttcgaccggctctacgacatcgcccctgccagcgcgatcgaggctgcgcgcgcc
aatgccgaagcgctgggcctcgatctggcggaagcggggatcagcgtcgattgcctgccg
ctgctcgacgtccgccagccgggcgcgcacgacgtcatcggggaccgtgcgctcggttcg
gaaccgatgcgcgttgcggcgctcggaagggcaacgctcgatgggctggcgcgcgcggga
attgcgggcgtggtcaagcacatgccgggccatggccgcgcgctggtcgatagccacaag
gaactgcccacggtctctgccagcgccgaggagctggaaatggacctcgctccgttccgc
gccctgcgcgatgccaccatcggcatgaccgcgcacctgcggttcctcgcatgggatgac
tggaacccggcgacgcactcgcccttcgtcatcgaggagatcatccgcaaggcgatcggc
ttcgacgggctgctcctgaccgacgatctcgatatgcaggcgcttggcggcaccgtgccc
gaacgcgcggcgcgcgcgcaggctgcgggctgcgacatcgccttgaattgctgggcgaag
atggatgacatggtcggcatcgcgaacagcctcgcgcccatgtctgacaaagtgatgcag
cggctggaacgcgcgctcgcgcccaccgcggccttcgacgctccagccgacatgaccgct
caggccgcgcttttcgacaagcgcgaccggttgctggaactggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system