KEGG   Novosphingobium aromaticivorans: Saro_1152Help
Entry
Saro_1152         CDS       T00322                                 

Definition
G-D-S-L lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Saro_1152
Enzymes [BR:nar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Saro_1152
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Saro_1152
Lipid biosynthesis proteins [BR:nar01004]
 Fatty acid synthase
  Component type
   Saro_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200770..1201453
Genome map
AA seq 227 aa AA seqDB search
MRRLALIAAILVAACSPEKNPDAQPTAAAQVSAPVPAGAPVILAFGDSLYAGYRLNPGEG
YPPRLEAALNAAGTPARVVNAGVSGDTTAAALQRLAFTLDNQPAKPVLALVGLGGNDMLR
GLPPEQTRDNLDAILTEFDKRGIPVVLTGMLAAPNLGADYARKFNPIWPELAKKHKAALV
PFFLQPVIGNKALMLDDNIHPNAQGVDRIVAATQAQVADALEAAIKP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacttgccctgattgccgccattctggtcgcggcctgctctcccgagaaaaac
ccagatgcccagcccaccgccgccgcgcaggtttcggcccccgtgcctgctggcgcgccc
gtgatcctcgcgttcggcgacagcctctatgccggctatcgcctcaacccgggtgaaggc
tatccgccgcgcctcgaagcggctctcaacgccgccggcacccctgcgcgcgtggtcaat
gccggcgtttcgggcgacaccaccgccgccgcgctccagcggctcgccttcacgctggac
aatcagccggcaaagcccgtgctcgcgcttgtcggcctcggcggcaacgacatgctgcgc
gggcttcccccggaacagacgcgcgacaatctcgatgcgatcctgaccgagttcgacaag
cgcggcattcccgtggtgctcacaggcatgctcgccgcgcccaacctcggcgcggattac
gcgcgcaagttcaatcccatctggcctgaacttgcaaagaagcacaaggcggcgctggtg
cccttcttcctgcaaccggtgatcggcaacaaggcgctgatgctggacgacaatatccac
cccaacgcgcagggcgtggacaggatcgtggctgccacgcaggcacaggtggccgatgca
ctggaggcggcgatcaagccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system