KEGG   Novosphingobium aromaticivorans: Saro_1179Help
Entry
Saro_1179         CDS       T00322                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saro_1179
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1179
  Amino acid metabolism
   00310 Lysine degradation
    Saro_1179
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Saro_1179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1218600..1219826)
Genome map
AA seq 408 aa AA seqDB search
MSIEVKVPTLGESVSEATVGQWLKKPGEAVALDEPIVSLETDKVAVEVPAPAAGVLGALV
ANEGDTVAVGALLALIEDGVAAAGAQAPAPRTEAPVPPASASEAPAAPAGDAAVLSPAVR
RAVLEYGIDPSTVKGTGKDGRLTKEDVMAAAAAKQAAPAAAVSAQAATPAAAPAGGRNEE
RVKMTRLRQTIAKRLKSAQETAALLTTFNDVDMSAVMEARAKYKDVFEKKHGVKLGLMSF
FAKASVLALKDIPSVNAQIQGDEIVYFDYVDISVAVSAPNGLVVPVVRDVDKMSFADIEK
SIADYGKKARDGALTMADMAGGTFTISNGGVFGGLMSTPIINPPQSAVLGLHRIEDRPVV
RNGEIVIRPMMYIALSYDHRIIDGREAVTALKTIKEAIEDPTRLLIDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtgaaggttccgacgctgggtgaaagcgtcagcgaagcaaccgtcggc
caatggctgaagaagcccggcgaagccgtggcgctggacgagcccatcgtcagcctggag
accgacaaggtcgcggtcgaagtgcccgcacctgccgcaggcgtgcttggcgcgctggtg
gcgaacgagggcgacaccgttgcggtcggcgcactgcttgcgctgatcgaggacggcgtg
gcggcggcgggcgcacaggcccctgccccgcgcaccgaagcgccggttccgcccgcttcg
gcatcggaagcccctgccgctccggcaggcgacgccgccgtgctttcgcccgccgtgcgc
cgcgcggtgctggaatacggtatcgacccgtcgaccgttaagggcaccggcaaggacggc
cgcctgaccaaggaagacgtcatggccgccgccgccgccaagcaggccgcgcccgccgct
gcggtttcggcccaggccgcaacccccgcggcggctccggccggtggtcgcaacgaagag
cgcgtcaagatgacgcgcctgcgccagaccatcgccaagcgcctcaagagcgcgcaggaa
accgccgccctgctcaccacgttcaacgacgtggacatgagcgcggtgatggaagcgcgc
gccaagtacaaggacgtgttcgagaagaagcacggcgtgaagctgggcctcatgtcgttc
ttcgccaaggcttcggtcctggcgctgaaggacatcccctcggtcaacgcgcagatccag
ggtgatgagatcgtctacttcgactacgtggacatctcggtcgcggtctcggccccgaac
gggctggtcgtgccggtggtgcgcgacgtcgacaagatgagcttcgccgacatcgagaag
tcgatcgccgactatggcaagaaggcacgcgatggcgcgctgaccatggcagacatggcg
ggcggcacgttcaccatctcgaacggcggcgttttcgggggcctgatgtcgaccccgatc
atcaacccgccgcagtcggccgtgcttggcctgcaccgcatcgaggatcgcccggtcgtg
cgcaacggcgagatcgtgatccgcccgatgatgtacatcgcgctgtcctacgaccatcgc
atcattgacggacgcgaggcggttacggcactcaagacgatcaaggaagcgatcgaggat
ccgacgcgcctgctgatcgatctgtga

DBGET integrated database retrieval system